SimulationCraft 1015-01

for World of Warcraft 10.2.0.52038 PTR (hotfix 2023-11-03/52038, git build f486e91d50)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)249,212248,013247,624246,907246,696239,053phial_of_corrupting_rage_3phial_of_static_empowerment_3phial_of_charged_isolation_3phial_of_elemental_chaos_3phial_of_tepid_versatility_3Base
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9122,2692,2612,2442,2432,242phial_of_corrupting_rage_3phial_of_tepid_versatility_3phial_of_elemental_chaos_3phial_of_static_empowerment_3phial_of_charged_isolation_3Base

Additional Raid Information

Base : 239053 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
239053.4 239053.4 119.3 / 0.050% 34612.4 / 14.5% 18804.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 99.8% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 239053
Astral Smolder 16137 6.7% 60.3 4.93s 80122 0 Periodic 112.8 42804 0 42804 0.0% 75.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.26 0.00 112.80 112.80 44.10 0.0000 2.0000 4828493.66 4828493.66 0.00% 21402.04 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 112.80 63 154 42804.36 9473 151655 42808.18 29329 58080 4828494 4828494 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7711) 0.0% (3.2%) 8.7 31.52s 266254 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13179 3.2% 154.2 1.69s 14977 11728 Direct 153.3 12159 24279 15071 24.0%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.22 153.26 0.00 0.00 0.00 1.2770 0.0000 2309762.81 2309762.81 0.00% 11728.02 11728.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.98% 116.44 24 327 12159.47 7923 21116 12148.92 10784 14143 1415842 1415842 0.00%
crit 24.02% 36.82 4 112 24279.40 15847 41597 24266.27 21178 29460 893920 893920 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.556
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:17996.75
Hungering Shadowflame 3910 1.6% 17.4 16.53s 67190 0 Direct 17.4 54186 107929 67194 24.2%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.44 17.44 0.00 0.00 0.00 0.0000 0.0000 1171789.00 1171789.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.79% 13.22 3 31 54185.73 35869 210762 54014.36 36203 124583 716196 716196 0.00%
crit 24.21% 4.22 0 14 107928.62 71739 421524 106265.62 0 416939 455593 455593 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3646 1.5% 35.1 8.33s 31078 0 Direct 35.0 25149 50256 31161 23.9%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.13 35.03 0.00 0.00 0.00 0.0000 0.0000 1091709.93 1091709.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.05% 26.64 9 51 25149.44 24387 28658 25148.63 24711 26150 670065 670065 0.00%
crit 23.95% 8.39 0 22 50255.81 48773 57316 50249.86 0 54819 421645 421645 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12836 5.4% 14.3 21.60s 267876 278531 Direct 14.3 9592 19733 12741 31.0%
Periodic 313.3 8674 18163 11674 31.6% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 313.32 313.32 13.34 0.9618 0.9518 3840380.93 3840380.93 0.00% 12308.56 278530.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.95% 9.89 2 17 9592.22 6259 17851 9595.80 7854 12188 94819 94819 0.00%
crit 31.05% 4.45 0 13 19732.94 13309 36107 19645.59 0 31213 87840 87840 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.38% 214.26 150 284 8673.77 64 15957 8678.04 8170 9331 1858405 1858405 0.00%
crit 31.62% 99.07 59 154 18162.78 3365 31913 18173.93 16789 19993 1799318 1799318 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (22773) 0.0% (9.5%) 17.0 17.94s 401110 339769

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.00 0.00 0.00 0.00 0.00 1.1806 0.0000 0.00 0.00 0.00% 339769.45 339769.45

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8340 3.5% 5.3 62.60s 472233 258177 Direct 5.3 336954 660664 475018 42.7%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.27 0.00 0.00 0.00 1.8291 0.0000 2505093.57 2505093.57 0.00% 258177.22 258177.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.34% 3.02 0 6 336953.66 198437 571175 332764.68 0 541066 1018799 1018799 0.00%
crit 42.66% 2.25 0 6 660663.91 404019 1124072 621283.60 0 1082131 1486294 1486294 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6181 2.6% 6.0 53.50s 307092 407076 Direct 6.0 206887 433194 308860 45.1%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1845275.38 1845275.38 0.00% 407075.97 407075.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.94% 3.28 0 7 206886.90 98828 324160 204986.55 0 315264 679135 679135 0.00%
crit 45.06% 2.69 0 7 433194.33 201914 658997 424301.14 0 648320 1166140 1166140 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8253 3.5% 5.7 57.78s 434100 357951 Direct 5.7 292724 581134 436501 49.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2128 0.0000 2469143.68 2469143.68 0.00% 357950.66 357950.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.15% 2.84 0 7 292724.12 152993 466052 286442.46 0 452772 830301 830301 0.00%
crit 49.85% 2.82 0 7 581134.46 330927 932103 567365.49 0 932103 1638843 1638843 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21311) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 7948 3.3% 96.0 3.10s 24797 0 Direct 95.7 17213 36161 24864 40.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.98 95.72 0.00 0.00 0.00 0.0000 0.0000 2379997.20 2379997.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.63% 57.08 26 95 17213.36 10130 34480 17219.84 15286 20027 982457 982457 0.00%
crit 40.37% 38.65 14 68 36161.05 20260 68960 36177.18 31165 42861 1397540 1397540 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 7963 3.3% 96.3 3.09s 24758 0 Direct 96.0 17189 36112 24828 40.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.32 96.05 0.00 0.00 0.00 0.0000 0.0000 2384619.37 2384619.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.63% 57.28 28 96 17188.92 10130 34480 17194.72 15153 19493 984498 984498 0.00%
crit 40.37% 38.77 16 67 36111.67 20260 68960 36129.43 31058 42688 1400121 1400121 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5399 2.3% 6.4 47.23s 252127 0 Direct 6.4 174332 366397 252842 40.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.39 0.00 0.00 0.00 0.0000 0.0000 1616527.78 1616527.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.12% 3.78 0 9 174332.20 102287 337023 173584.89 0 327620 658940 658940 0.00%
crit 40.88% 2.61 0 8 366396.56 208022 687451 352364.15 0 671114 957588 957588 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5816 2.4% 25.9 11.49s 67330 74714 Direct 26.9 47394 94596 64832 36.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.94 26.94 0.00 0.00 0.00 0.9012 0.0000 1746364.80 1746364.80 0.00% 74713.99 74713.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.06% 16.99 5 31 47394.14 20923 93592 47388.24 38500 55669 805039 805039 0.00%
crit 36.94% 9.95 0 23 94596.04 41846 182145 94546.39 0 127472 941326 941326 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:24.99
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 77698 (104916) 32.5% (43.9%) 116.7 2.55s 268867 275245 Direct 116.4 (154.7) 141239 292965 199537 38.4% (39.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.69 116.44 0.00 0.00 0.00 0.9768 0.0000 23233956.07 23233956.07 0.00% 275244.73 275244.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.58% 71.70 44 104 141239.23 85791 274091 141307.39 128856 155558 10126234 10126234 0.00%
crit 38.42% 44.74 21 71 292965.01 185208 548182 293211.67 259695 339264 13107722 13107722 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.35
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.33
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27217 11.4% 38.5 7.69s 211439 0 Direct 38.3 148531 306057 212473 40.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.49 38.31 0.00 0.00 0.00 0.0000 0.0000 8138989.25 8138989.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.41% 22.76 6 43 148530.63 96832 286604 148595.73 121729 188373 3380201 3380201 0.00%
crit 40.59% 15.55 2 35 306056.75 193663 573209 306268.40 246965 412510 4758788 4758788 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 12867 5.4% 17.4 18.04s 221687 230817 Direct 17.4 9590 19465 12998 34.5%
Periodic 314.3 8551 17352 11539 34.0% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 314.28 314.28 16.38 0.9605 0.9518 3852558.78 3852558.78 0.00% 12197.78 230816.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.49% 11.38 1 20 9590.33 5690 16674 9580.76 7864 11411 109147 109147 0.00%
crit 34.51% 6.00 0 17 19465.16 11381 33347 19447.55 0 28077 116747 116747 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.04% 207.55 140 277 8550.57 50 15120 8549.92 8114 9010 1774688 1774688 0.00%
crit 33.96% 106.73 66 158 17351.78 1285 30240 17353.36 16234 18696 1851977 1851977 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.94
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4143) 0.0% (1.7%) 8.6 31.94s 143965 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2159 0.9% 8.6 31.94s 75007 0 Direct 8.6 60485 120851 75007 24.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 8.62 0.00 0.00 0.00 0.0000 0.0000 646812.26 646812.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.94% 6.55 0 18 60485.17 58599 68863 60454.26 0 68863 396107 396107 0.00%
crit 24.06% 2.07 0 9 120850.52 117198 137726 106712.77 0 137726 250706 250706 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1985 0.8% 16.7 15.55s 35617 0 Direct 16.7 28764 57473 35616 23.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.70 16.70 0.00 0.00 0.00 0.0000 0.0000 594647.28 594647.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.13% 12.71 1 34 28764.15 27883 32767 28763.30 27883 31268 365609 365609 0.00%
crit 23.87% 3.99 0 16 57473.26 55766 65534 56295.37 0 65534 229038 229038 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 22988 9.6% 117.8 2.49s 58393 62281 Direct 117.4 40233 83095 58612 42.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.79 117.35 0.00 0.00 0.00 0.9376 0.0000 6878170.12 6878170.12 0.00% 62281.39 62281.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.12% 67.04 36 98 40233.30 15445 126045 40239.74 35633 46229 2697065 2697065 0.00%
crit 42.88% 50.32 21 80 83095.01 30891 253871 83127.98 71631 101092 4181105 4181105 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.11

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 191.52s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.36s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.19s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.06
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.16% 29.15% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 49.6s
  • trigger_min/max:2.7s / 49.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.07% / 28.09%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.44%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.77% 54.74% 3.0 (17.8) 17.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.6s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:46.00% / 54.88%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.02%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.37%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.9 44.2s 4.1s 20.2s 48.65% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:0.8s / 42.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.98% / 54.99%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.35%
  • balance_t31_4pc_buff_lunar_3:4.89%
  • balance_t31_4pc_buff_lunar_4:5.61%
  • balance_t31_4pc_buff_lunar_5:29.19%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.7 22.0s 2.6s 19.4s 90.58% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.06% / 93.48%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.52%
  • balance_t31_4pc_buff_solar_2:11.44%
  • balance_t31_4pc_buff_solar_3:16.00%
  • balance_t31_4pc_buff_solar_4:11.64%
  • balance_t31_4pc_buff_solar_5:43.97%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.3s 70.3s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.1s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.63%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.7s 70.3s 45.6s 33.23% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 355.7s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.23%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 346.0s
  • trigger_min/max:12.0s / 346.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.98%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.9s 70.3s 45.9s 33.54% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 346.9s
  • trigger_min/max:12.0s / 346.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.54%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.5s 70.5s 10.8s 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.0s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.13%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.7s 70.5s 45.6s 33.23% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.3s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.23%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Denizen of the Dream 8.7 0.0 45.1s 31.5s 41.5s 57.88% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 290.4s
  • trigger_min/max:0.0s / 147.3s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 286.5s
  • uptime_min/max:20.72% / 96.63%

Stack Uptimes

  • denizen_of_the_dream_1:38.63%
  • denizen_of_the_dream_2:14.72%
  • denizen_of_the_dream_3:3.72%
  • denizen_of_the_dream_4:0.69%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.29% 20.61% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:8.20% / 26.72%

Stack Uptimes

  • dreamstate_1:9.46%
  • dreamstate_2:5.83%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.2s 20.6s 49.66% 52.79% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.66%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.5 22.3s 15.8s 20.2s 93.10% 96.26% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.6s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.50% / 95.73%

Stack Uptimes

  • eclipse_solar_1:93.10%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.9s 306.9s 27.4s 13.22% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.22%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.3s 31.5s 25.1s 44.00% 43.94% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 201.5s
  • trigger_min/max:0.0s / 147.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.5s
  • uptime_min/max:13.81% / 84.41%

Stack Uptimes

  • friend_of_the_fae_1:44.00%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.3s 48.75% 51.53% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.36% / 54.99%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.75%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.35% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 125.3s
  • trigger_min/max:90.0s / 125.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.29% / 26.39%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.48% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.67% / 30.66%

Stack Uptimes

  • natures_grace_1:25.48%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 73.7s 67.6s 7.7s 6.40% 7.09% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 334.2s
  • trigger_min/max:0.1s / 334.2s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 31.1s
  • uptime_min/max:0.00% / 24.93%

Stack Uptimes

  • owlkin_frenzy_1:6.40%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.4 38.3s 38.3s 34.3s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.4s / 50.0s
  • trigger_min/max:24.4s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.4s
  • uptime_min/max:90.79% / 96.89%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.26%
  • primordial_arcanic_pulsar_12:6.73%
  • primordial_arcanic_pulsar_16:6.79%
  • primordial_arcanic_pulsar_20:6.58%
  • primordial_arcanic_pulsar_24:6.04%
  • primordial_arcanic_pulsar_28:6.92%
  • primordial_arcanic_pulsar_32:8.30%
  • primordial_arcanic_pulsar_36:6.61%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:7.31%
  • primordial_arcanic_pulsar_48:6.87%
  • primordial_arcanic_pulsar_52:7.70%
  • primordial_arcanic_pulsar_56:6.76%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.69% 39.91% 3.7 (3.7) 18.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.8s
  • uptime_min/max:36.19% / 42.83%

Stack Uptimes

  • solstice_1:39.69%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 95.9 14.7s 2.6s 14.1s 97.35% 0.00% 54.8 (54.8) 7.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.20% / 99.11%

Stack Uptimes

  • starlord_1:9.23%
  • starlord_2:14.74%
  • starlord_3:73.38%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.2 47.9s 5.5s 43.2s 90.19% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 325.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:72.98% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.19%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.0s 45.6s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 224.9s
  • trigger_min/max:0.0s / 217.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.6s
  • uptime_min/max:4.50% / 65.60%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.80% 42.92% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:Base
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.38% / 50.70%

Stack Uptimes

  • warrior_of_elune_1:20.32%
  • warrior_of_elune_2:5.34%
  • warrior_of_elune_3:18.14%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 23.0 31.5s 0.0s 147.3s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 28.4s 49.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.40% 0.4s 0.0s 2.8s
Astral Smolder 75.51% 49.47% 91.74% 14.0s 0.0s 100.0s
Incarnation (Total) 48.75% 43.36% 54.99% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.48% 26.06% 31.02% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.35% 36.09% 50.48% 11.0s 0.0s 15.0s
No Eclipse 5.97% 3.01% 8.39% 1.4s 0.0s 3.6s
Friend of the Fae 44.00% 13.81% 84.41% 25.1s 0.0s 145.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8440.00036.94747.61426.13474.482
Full Moon
New Moon
Half Moon
0.3420.00023.3955.8075.28129.007

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.094.4%57.7849.9%0.000.0%52.9245.7%
Starfire24.9392.5%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.5939.9%0.000.0%70.1060.1%
New Moon0.020.3%0.264.4%0.000.0%5.7395.3%
Half Moon0.000.0%0.335.7%0.000.0%5.3694.3%
Full Moon0.201.7%3.1026.4%0.080.6%8.3471.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Nature's BalanceAstral Power99.38198.675.41%2.000.100.05%
Full MoonAstral Power5.30264.857.21%49.930.360.14%
Half MoonAstral Power5.69136.523.72%24.000.000.00%
MoonfireAstral Power14.3485.952.34%6.000.060.07%
New MoonAstral Power6.0172.111.96%12.000.000.00%
Orbit BreakerAstral Power6.41191.225.20%29.821.120.58%
Shooting Stars (Moonfire)Astral Power95.97191.765.22%2.000.190.10%
Shooting Stars (Sunfire)Astral Power96.31192.435.24%2.000.190.10%
StarfireAstral Power26.94394.8010.74%14.662.890.73%
SunfireAstral Power17.38104.262.84%6.000.010.01%
WrathAstral Power117.791842.1150.13%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarsurgeAstral Power 116.863686.79100.00%31.5531.608509.55
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 1950.37 2240.57 2264240.5 809080.1 370427.2 896040.0
Astral Power 70.0 12.26 12.28 4.9 23.5 0.0 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 21100
Mean 299.65
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.7526
5th Percentile 245.67
95th Percentile 353.81
( 95th Percentile - 5th Percentile ) 108.14
Mean Distribution
Standard Deviation 0.2392
95.00% Confidence Interval ( 299.18 - 300.12 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 517
0.1% Error 51670
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1031
DPS
Base Damage Per Second
Count 21100
Mean 239053.41
Minimum 205331.02
Maximum 281046.39
Spread ( max - min ) 75715.37
Range [ ( max - min ) / 2 * 100% ] 15.84%
Standard Deviation 8838.4508
5th Percentile 225043.86
95th Percentile 254028.78
( 95th Percentile - 5th Percentile ) 28984.92
Mean Distribution
Standard Deviation 60.8464
95.00% Confidence Interval ( 238934.15 - 239172.66 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5252
0.1 Scale Factor Error with Delta=300 666863
0.05 Scale Factor Error with Delta=300 2667449
0.01 Scale Factor Error with Delta=300 66686201
Priority Target DPS
Base Priority Target Damage Per Second
Count 21100
Mean 239053.41
Minimum 205331.02
Maximum 281046.39
Spread ( max - min ) 75715.37
Range [ ( max - min ) / 2 * 100% ] 15.84%
Standard Deviation 8838.4508
5th Percentile 225043.86
95th Percentile 254028.78
( 95th Percentile - 5th Percentile ) 28984.92
Mean Distribution
Standard Deviation 60.8464
95.00% Confidence Interval ( 238934.15 - 239172.66 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5252
0.1 Scale Factor Error with Delta=300 666863
0.05 Scale Factor Error with Delta=300 2667449
0.01 Scale Factor Error with Delta=300 66686201
DPS(e)
Base Damage Per Second (Effective)
Count 21100
Mean 239053.41
Minimum 205331.02
Maximum 281046.39
Spread ( max - min ) 75715.37
Range [ ( max - min ) / 2 * 100% ] 15.84%
Damage
Base Damage
Count 21100
Mean 69224529.06
Minimum 51839323.49
Maximum 89225486.03
Spread ( max - min ) 37386162.54
Range [ ( max - min ) / 2 * 100% ] 27.00%
DTPS
Base Damage Taken Per Second
Count 21100
Mean 2241.85
Minimum 849.65
Maximum 4488.28
Spread ( max - min ) 3638.63
Range [ ( max - min ) / 2 * 100% ] 81.15%
HPS
Base Healing Per Second
Count 21100
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 21100
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 21100
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 21100
Mean 1947.52
Minimum 584.78
Maximum 4488.28
Spread ( max - min ) 3903.49
Range [ ( max - min ) / 2 * 100% ] 100.22%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.06 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 24.99 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.35 starsurge,if=variable.starsurge_condition1
R 15.94 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.33 starsurge,if=variable.starsurge_condition2
Y 116.11 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

12456789ACFJKLNDEQQQTQUQVQYYYXRYXYWQQSQYYXYYXYYXOTYXYXYYQQQRYYYYXYSXYYXXYPPQQRYQYYYYXYXPPQSYQUQRYQOQVXWQYPPQQYYQSRYYYWQFQYYPPQQYYQYYRYQSQETUQYQYYYOXXWYPPQQRQYYSYYXYXYYPPQQRYQYYYYXYSXPPQQVQQRQOTYXYYXPPWQQYSQYYRYYXYFXYNUQQVQQQYYQRSYYYWQEQQYYYYXYTXYXXYRYQQQSYOYYYXXYXUYWQQRQYYYXYPPQSX

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 1 food Base 50.0/100: 50% astral_power
Pre precombat 2 augmentation Base 50.0/100: 50% astral_power
Pre precombat 4 no_cd_talent Base 50.0/100: 50% astral_power
Pre precombat 5 on_use_trinket Base 50.0/100: 50% astral_power
Pre precombat 6 on_use_trinket Base 50.0/100: 50% astral_power
Pre precombat 7 on_use_trinket Base 50.0/100: 50% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil Base 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.925 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, wafting_devotion
0:01.782 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, wafting_devotion
0:02.554 st N incarnation_chosen_of_elune Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, wafting_devotion
0:02.554 default D potion Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion
0:02.554 default E use_items Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power
0:02.554 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.335 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.090 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(95)
0:04.843 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.599 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.354 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.283 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.036 st V full_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.425 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.181 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.937 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.694 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.450 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.205 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.961 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.714 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.468 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.223 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.223 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.004 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.760 st S moonfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.513 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.268 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.024 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.778 st X starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.533 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.289 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.044 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:23.798 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:24.551 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.305 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.058 st O warrior_of_elune Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.058 st T new_moon Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.813 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.567 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:28.321 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.077 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.831 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:30.584 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.337 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.179 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.990 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
0:33.770 st R sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
0:34.525 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
0:35.280 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
0:36.036 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:36.790 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:37.545 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:38.301 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:39.054 st S moonfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:39.808 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:40.562 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:41.537 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:42.511 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:43.486 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:44.462 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
0:45.439 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
0:46.191 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
0:46.946 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:48.039 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
0:49.089 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:50.100 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:51.113 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:52.224 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:53.299 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:54.373 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:55.446 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:56.518 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:57.590 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
0:58.663 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
0:59.738 st P starfire Fluffy_Pillow 23.6/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:01.347 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
1:02.224 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
1:03.317 st S moonfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
1:04.369 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
1:05.123 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
1:06.174 st U half_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
1:07.399 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
1:08.411 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
1:09.383 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak
1:10.358 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
1:11.334 st O warrior_of_elune Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
1:11.334 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
1:12.310 st V full_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
1:14.258 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak
1:15.234 st W cancel_buff Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
1:15.234 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
1:16.325 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
1:17.375 st P starfire Fluffy_Pillow 33.6/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), dreamstate, best_friends_with_pip_static
1:18.128 st P starfire Fluffy_Pillow 52.4/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(2), best_friends_with_pip_static
1:18.883 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, best_friends_with_pip_static
1:19.935 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static
1:20.947 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:21.922 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:22.897 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:23.874 st S moonfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:24.947 st R sunfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:26.020 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:27.093 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:28.167 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:29.240 st W cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:29.240 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:30.441 default F natures_vigil Base 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
1:30.441 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
1:31.598 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
1:32.709 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
1:33.820 st P starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak
1:34.574 st P starfire Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_pip_static, undulating_sporecloak
1:35.486 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak
1:36.498 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
1:37.474 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:38.450 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:39.426 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:40.501 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:41.575 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:42.649 st R sunfire Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:43.722 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:44.796 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:45.999 st S moonfire Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
1:47.155 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
1:48.309 default E use_items Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak
1:48.309 st T new_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:49.064 st U half_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:50.409 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(90)
1:51.420 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(85)
1:52.395 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
1:53.371 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(75)
1:54.346 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(70)
1:55.321 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
1:56.296 st O warrior_of_elune Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
1:56.334 st X starsurge Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(60)
1:57.310 st X starsurge Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
1:58.286 st W cancel_buff Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
1:58.286 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
1:59.379 st P starfire Fluffy_Pillow 26.0/100: 26% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(45)
2:00.132 st P starfire Fluffy_Pillow 44.8/100: 45% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(45)
2:00.888 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(40)
2:01.981 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(35)
2:03.031 st R sunfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(30)
2:04.043 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(25)
2:05.055 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(20)
2:06.028 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(15)
2:07.101 st S moonfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(10)
2:08.176 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(5)
2:09.250 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:10.322 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
2:11.393 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:12.467 st X starsurge Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:13.541 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:14.613 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
2:15.686 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static
2:16.442 st P starfire Fluffy_Pillow 78.4/100: 78% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), best_friends_with_urctos(8), best_friends_with_urctos_static
2:17.425 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_urctos(7), best_friends_with_urctos_static
2:18.519 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos(5), best_friends_with_urctos_static
2:19.569 st R sunfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(4), best_friends_with_urctos_static
2:20.581 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
2:21.594 st Q starsurge Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
2:22.706 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
2:23.780 st Y wrath Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:24.853 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:25.927 st Y wrath Fluffy_Pillow 74.4/100: 74% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:27.000 st X starsurge Fluffy_Pillow 94.4/100: 94% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:28.073 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:29.145 st S moonfire Fluffy_Pillow 74.4/100: 74% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:30.219 st X starsurge Fluffy_Pillow 84.4/100: 84% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:31.293 st P starfire Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:32.900 st P starfire Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:33.883 st Q starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:34.975 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:35.929 st V full_moon Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:37.765 st Q starsurge Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:38.684 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:39.660 st R sunfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:40.636 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
2:41.612 st O warrior_of_elune Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:41.612 st T new_moon Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:42.365 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:43.120 st X starsurge Fluffy_Pillow 36.4/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:44.024 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:44.930 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:45.836 st X starsurge Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:46.739 st P starfire Fluffy_Pillow 14.4/100: 14% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:47.494 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:48.246 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:48.246 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:49.258 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:50.231 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:51.167 st S moonfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:52.104 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:53.134 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:54.128 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:55.122 st R sunfire Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:56.118 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:57.113 st Y wrath Fluffy_Pillow 74.0/100: 74% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:58.188 st X starsurge Fluffy_Pillow 92.0/100: 92% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:59.261 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
3:00.335 default F natures_vigil Base 74.0/100: 74% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
3:00.441 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
3:01.514 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
3:02.589 st N incarnation_chosen_of_elune Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:02.589 st U half_moon Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:03.772 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:04.765 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:05.722 st V full_moon Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:07.561 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:08.481 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:09.371 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:10.347 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:11.101 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:11.856 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:12.833 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:13.809 st S moonfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:14.784 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:15.760 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:16.665 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:17.569 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:17.569 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:18.582 default E use_items Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:18.582 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
3:19.555 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
3:20.493 st Y wrath Fluffy_Pillow 2.0/100: 2% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
3:21.398 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(90)
3:22.302 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(85)
3:23.205 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(80)
3:24.110 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(75)
3:25.015 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(70)
3:25.919 st T new_moon Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(65)
3:26.674 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(60)
3:27.580 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(60)
3:28.483 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(55)
3:29.386 st X starsurge Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(50)
3:30.290 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(45)
3:31.194 st R sunfire Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(40)
3:32.170 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(35)
3:33.147 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(30)
3:34.241 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(25)
3:35.293 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(20)
3:36.303 st S moonfire Fluffy_Pillow 14.0/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(15)
3:37.279 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(10)
3:38.253 st O warrior_of_elune Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(5)
3:38.253 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(5)
3:39.229 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:40.204 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:41.182 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:42.158 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:43.134 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:44.110 st X starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:45.085 st U half_moon Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:46.603 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:47.577 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:47.577 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:48.670 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:49.722 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:50.733 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:51.745 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:52.720 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:53.697 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:54.674 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:55.650 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:56.627 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:57.380 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
3:58.134 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:59.108 st S moonfire Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
4:00.084 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 22.51% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="Base"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=disabled
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_charged_isolation_3 : 247624 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
247623.6 247623.6 123.7 / 0.050% 35614.9 / 14.4% 19483.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_charged_isolation_3 247624
Astral Smolder 16781 6.8% 60.4 4.90s 83283 0 Periodic 113.0 44512 0 44512 0.0% 75.3%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.39 0.00 113.00 113.00 44.21 0.0000 2.0000 5029617.83 5029617.83 0.00% 22255.44 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 113.00 58 156 44511.65 9867 155740 44518.06 31927 58997 5029618 5029618 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7967) 0.0% (3.2%) 8.6 31.50s 276661 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13646 3.2% 153.7 1.70s 15558 12184 Direct 152.7 12637 25223 15655 24.0%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.66 152.71 0.00 0.00 0.00 1.2770 0.0000 2390619.29 2390619.29 0.00% 12183.55 12183.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.02% 116.10 21 360 12637.07 9262 21694 12625.69 11352 14737 1467129 1467129 0.00%
crit 23.98% 36.61 5 111 25223.32 16862 42755 25210.38 22155 30671 923490 923490 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.418
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16853.69
Hungering Shadowflame 3918 1.6% 17.5 16.61s 67300 0 Direct 17.5 54244 108478 67308 24.1%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.47 17.47 0.00 0.00 0.00 0.0000 0.0000 1175784.83 1175784.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.91% 13.26 3 28 54243.76 35869 210762 54077.77 36256 118493 719469 719469 0.00%
crit 24.09% 4.21 0 14 108477.83 71739 421524 106660.73 0 421524 456316 456316 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3639 1.5% 35.1 8.37s 31088 0 Direct 35.0 25155 50269 31172 24.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.12 35.03 0.00 0.00 0.00 0.0000 0.0000 1091799.51 1091799.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.04% 26.63 10 50 25154.55 24387 28658 25153.78 24718 26177 669953 669953 0.00%
crit 23.96% 8.39 0 23 50268.64 48773 57316 50259.60 0 56693 421847 421847 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13328 5.4% 14.4 21.60s 278204 289284 Direct 14.4 9974 20494 13246 31.1%
Periodic 313.8 9010 18853 12122 31.6% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.36 14.36 313.83 313.83 13.36 0.9618 0.9519 3994431.75 3994431.75 0.00% 12780.71 289283.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.89% 9.89 2 17 9973.87 6601 18864 9978.23 8173 12619 98658 98658 0.00%
crit 31.11% 4.47 0 12 20493.90 14747 37318 20400.29 0 32851 91531 91531 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.39% 214.62 146 282 9010.29 652 16412 9014.82 8502 9738 1933766 1933766 0.00%
crit 31.61% 99.21 56 148 18853.06 2613 32824 18864.32 17416 20690 1870476 1870476 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.11
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23582) 0.0% (9.5%) 17.0 17.95s 415369 351761

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 0.00 0.00 0.00 1.1808 0.0000 0.00 0.00 0.00% 351761.11 351761.11

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8650 3.5% 5.3 62.52s 489574 267584 Direct 5.3 349416 685648 492390 42.5%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8298 0.0000 2601723.09 2601723.09 0.00% 267584.40 267584.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.48% 3.04 0 6 349415.91 199536 587763 344659.54 0 557628 1061151 1061151 0.00%
crit 42.52% 2.25 0 6 685648.07 424468 1157279 644602.34 0 1124512 1540572 1540572 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6389 2.6% 6.0 53.53s 317351 420681 Direct 6.0 214064 447421 319159 45.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.99 0.00 0.00 0.00 0.7545 0.0000 1910734.19 1910734.19 0.00% 420681.24 420681.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.97% 3.29 0 7 214063.62 106473 335443 211960.61 0 320242 704452 704452 0.00%
crit 45.03% 2.70 0 7 447421.38 210315 660309 438733.37 0 648754 1206282 1206282 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8543 3.5% 5.7 57.76s 449755 370799 Direct 5.7 302671 601629 452120 50.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2129 0.0000 2561106.83 2561106.83 0.00% 370798.73 370798.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.01% 2.83 0 7 302670.96 169243 479875 296116.44 0 459100 857336 857336 0.00%
crit 49.99% 2.83 0 7 601628.93 299735 959750 587625.20 0 905221 1703771 1703771 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22089) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8240 3.3% 96.1 3.11s 25721 0 Direct 95.8 17879 37533 25792 40.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.08 95.81 0.00 0.00 0.00 0.0000 0.0000 2471293.97 2471293.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.73% 57.23 26 97 17879.44 10551 35464 17886.29 15826 20257 1023307 1023307 0.00%
crit 40.27% 38.58 16 68 37532.70 21103 70928 37550.12 32682 45885 1447987 1447987 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8262 3.3% 96.4 3.09s 25701 0 Direct 96.1 17855 37472 25772 40.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.42 96.15 0.00 0.00 0.00 0.0000 0.0000 2478018.05 2478018.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.64% 57.34 26 93 17854.70 10551 35464 17860.08 15726 21297 1023810 1023810 0.00%
crit 40.36% 38.81 17 69 37472.30 21103 70928 37488.80 31734 43454 1454208 1454208 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5586 2.3% 6.4 47.31s 261202 0 Direct 6.4 180910 380244 262031 40.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.39 0.00 0.00 0.00 0.0000 0.0000 1675360.97 1675360.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.31% 3.79 0 8 180910.23 106543 353537 180176.51 0 321581 686081 686081 0.00%
crit 40.69% 2.60 0 8 380244.31 213085 716203 365716.03 0 676187 989280 989280 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6060 2.5% 26.0 11.51s 70094 77780 Direct 27.0 49338 98431 67500 37.0%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.00 27.00 0.00 0.00 0.00 0.9012 0.0000 1822769.65 1822769.65 0.00% 77779.80 77779.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.01% 17.02 4 31 49338.31 21794 98455 49336.09 40860 59203 839487 839487 0.00%
crit 36.99% 9.99 1 22 98431.07 43587 194205 98385.95 44921 122298 983283 983283 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.06
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80618 (108847) 32.5% (43.9%) 116.9 2.56s 279026 285606 Direct 116.6 (155.0) 146638 304041 207097 38.4% (38.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.85 116.60 0.00 0.00 0.00 0.9770 0.0000 24148282.61 24148282.61 0.00% 285606.24 285606.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.59% 71.81 44 102 146638.03 88256 281914 146712.16 134827 163625 10530226 10530226 0.00%
crit 38.41% 44.79 18 72 304040.57 192913 563828 304270.39 266485 344158 13618057 13618057 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.47
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.38
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28229 11.4% 38.6 7.66s 219380 0 Direct 38.4 154272 317685 220465 40.5%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.55 38.36 0.00 0.00 0.00 0.0000 0.0000 8457096.69 8457096.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.49% 22.82 5 43 154271.87 100860 294785 154338.60 126632 194849 3520573 3520573 0.00%
crit 40.51% 15.54 4 36 317684.86 201721 589570 317917.61 254084 407597 4936524 4936524 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13363 5.4% 17.4 18.05s 230295 239766 Direct 17.4 9971 20218 13521 34.6%
Periodic 314.8 8883 18019 11984 33.9% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 314.79 314.79 16.40 0.9605 0.9519 4007689.58 4007689.58 0.00% 12667.69 239766.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.35% 11.37 3 20 9970.74 5927 17149 9961.51 8425 11784 113399 113399 0.00%
crit 34.65% 6.03 0 16 20217.68 11854 35189 20210.34 0 30080 121901 121901 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.06% 207.95 144 280 8883.14 3153 15534 8882.50 8425 9415 1847231 1847231 0.00%
crit 33.94% 106.84 62 159 18018.76 1171 31068 18020.12 16812 19432 1925159 1925159 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.97
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4164) 0.0% (1.7%) 8.7 31.30s 144098 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2168 0.9% 8.7 31.30s 75013 0 Direct 8.7 60498 120881 75013 24.0%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.67 8.67 0.00 0.00 0.00 0.0000 0.0000 650478.16 650478.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.96% 6.59 0 21 60498.12 58599 68863 60480.18 0 68114 398513 398513 0.00%
crit 24.04% 2.08 0 10 120881.21 117198 137726 106708.63 0 137726 251965 251965 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1996 0.8% 16.8 15.20s 35675 0 Direct 16.8 28772 57486 35675 24.0%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.79 16.79 0.00 0.00 0.00 0.0000 0.0000 599075.50 599075.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.96% 12.76 1 34 28772.27 27883 32767 28770.88 27883 31250 367006 367006 0.00%
crit 24.04% 4.04 0 14 57485.97 55766 65534 56145.71 0 65534 232069 232069 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23887 9.6% 118.0 2.49s 60680 64714 Direct 117.5 41806 86352 60911 42.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.98 117.54 0.00 0.00 0.00 0.9377 0.0000 7159209.12 7159209.12 0.00% 64714.26 64714.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.11% 67.13 37 98 41806.30 16088 129954 41815.11 36590 48031 2806541 2806541 0.00%
crit 42.89% 50.41 23 85 86352.39 32176 269835 86388.17 73828 101984 4352668 4352668 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_charged_isolation_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Charged Isolation 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371386
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 191.73s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.34s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.44s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.14s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.07
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.14% 29.12% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.1s
  • trigger_min/max:2.7s / 50.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.25% / 27.88%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.78% 54.75% 3.0 (17.8) 17.8

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.2s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.3s
  • uptime_min/max:45.93% / 55.00%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.02%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.37%
  • balance_of_all_things_nature_6:6.52%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.0 44.2s 4.1s 20.2s 48.60% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.7s
  • trigger_min/max:0.8s / 42.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.09% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.62%
  • balance_t31_4pc_buff_lunar_2:4.36%
  • balance_t31_4pc_buff_lunar_3:4.89%
  • balance_t31_4pc_buff_lunar_4:5.61%
  • balance_t31_4pc_buff_lunar_5:29.12%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.1 102.8 22.0s 2.6s 19.3s 90.56% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.04% / 93.25%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.53%
  • balance_t31_4pc_buff_solar_2:11.47%
  • balance_t31_4pc_buff_solar_3:15.99%
  • balance_t31_4pc_buff_solar_4:11.66%
  • balance_t31_4pc_buff_solar_5:43.91%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.9s 70.9s 10.8s 9.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.4s
  • trigger_min/max:12.0s / 341.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.19%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.88%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.89%
  • best_friends_with_aerwynn_4:0.89%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.90%
  • best_friends_with_aerwynn_7:0.90%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.91%
  • best_friends_with_aerwynn_10:0.91%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.5s 70.9s 45.4s 33.00% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.6s
  • trigger_min/max:12.0s / 341.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 304.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.00%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.1s 70.1s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 337.5s
  • trigger_min/max:12.0s / 337.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.53%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.4s 70.1s 45.5s 33.33% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 355.5s
  • trigger_min/max:12.0s / 337.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 333.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.33%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.1s 70.1s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.4s
  • trigger_min/max:12.0s / 341.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.24%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.2s 70.1s 45.9s 33.66% 0.00% 70.2 (70.2) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.9s
  • trigger_min/max:12.0s / 341.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 321.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.66%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Denizen of the Dream 8.6 0.0 45.0s 31.7s 41.3s 57.74% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 268.2s
  • trigger_min/max:0.0s / 141.6s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 249.4s
  • uptime_min/max:19.84% / 96.90%

Stack Uptimes

  • denizen_of_the_dream_1:38.70%
  • denizen_of_the_dream_2:14.60%
  • denizen_of_the_dream_3:3.68%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.27% 20.62% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.1s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s
  • uptime_min/max:8.56% / 26.00%

Stack Uptimes

  • dreamstate_1:9.46%
  • dreamstate_2:5.82%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.6s 44.2s 20.6s 49.61% 52.74% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.7s
  • trigger_min/max:12.0s / 89.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.21% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.61%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.8s 20.1s 93.09% 96.26% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.4s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.82% / 95.27%

Stack Uptimes

  • eclipse_solar_1:93.09%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.1s 307.1s 27.4s 13.24% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.24%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.3s 31.7s 25.0s 43.86% 43.80% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 186.7s
  • trigger_min/max:0.0s / 141.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 166.6s
  • uptime_min/max:15.10% / 87.74%

Stack Uptimes

  • friend_of_the_fae_1:43.86%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.2s 48.70% 51.48% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.7s
  • trigger_min/max:12.0s / 89.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.46% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.70%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.34% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.8s
  • trigger_min/max:90.0s / 124.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.38% / 26.59%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.50% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.4s
  • trigger_min/max:12.8s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:21.29% / 30.85%

Stack Uptimes

  • natures_grace_1:25.50%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.50% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.0s 67.9s 7.7s 6.37% 7.07% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 342.9s
  • trigger_min/max:0.1s / 342.9s
  • trigger_pct:14.95%
  • duration_min/max:0.0s / 29.1s
  • uptime_min/max:0.00% / 28.28%

Stack Uptimes

  • owlkin_frenzy_1:6.37%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.6 38.4s 38.4s 34.3s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.0s / 49.6s
  • trigger_min/max:24.0s / 49.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s
  • uptime_min/max:90.02% / 96.72%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.01%
  • primordial_arcanic_pulsar_8:5.25%
  • primordial_arcanic_pulsar_12:6.72%
  • primordial_arcanic_pulsar_16:6.80%
  • primordial_arcanic_pulsar_20:6.55%
  • primordial_arcanic_pulsar_24:6.06%
  • primordial_arcanic_pulsar_28:6.92%
  • primordial_arcanic_pulsar_32:8.28%
  • primordial_arcanic_pulsar_36:6.63%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:7.33%
  • primordial_arcanic_pulsar_48:6.85%
  • primordial_arcanic_pulsar_52:7.71%
  • primordial_arcanic_pulsar_56:6.77%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.71% 39.91% 3.7 (3.7) 18.3

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.00% / 42.76%

Stack Uptimes

  • solstice_1:39.71%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.1 14.7s 2.6s 14.0s 97.34% 0.00% 54.9 (54.9) 7.6

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.9s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.34% / 99.13%

Stack Uptimes

  • starlord_1:9.25%
  • starlord_2:14.75%
  • starlord_3:73.35%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 48.1s 5.5s 43.3s 90.19% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 340.0s
  • trigger_min/max:5.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.0s
  • uptime_min/max:72.00% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.19%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.0s 45.6s 16.5s 23.71% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 215.7s
  • trigger_min/max:0.0s / 212.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.1s
  • uptime_min/max:4.88% / 58.18%

Stack Uptimes

  • wafting_devotion_1:23.71%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.81% 42.94% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.35% / 51.11%

Stack Uptimes

  • warrior_of_elune_1:20.39%
  • warrior_of_elune_2:5.27%
  • warrior_of_elune_3:18.14%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Charged Isolation

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_phial_of_charged_isolation
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:371386
  • name:Phial of Charged Isolation
  • tooltip:Primary stat is increased by {$=}w1 while at least {$371385=}A1 yds from allies. {$=}w2% of this stat will linger for {$384713d=2.500 seconds} after being near an ally.
  • description:Primary stat is increased by {$s1=303} while at least {$371385=}A1 yds from allies. You will retain {$=}M2% of this stat for {$384713d=2.500 seconds} after being near an ally. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Charged Isolation (_stats)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_phial_of_charged_isolation_stats
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:598.00

Spelldata

  • id:371387
  • name:Phial of Charged Isolation
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc371386=Primary stat is increased by {$s1=303} while at least {$371385=}A1 yds from allies. You will retain {$=}M2% of this stat for {$384713d=2.500 seconds} after being near an ally. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 27.0 31.7s 0.0s 141.6s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 29.5s 50.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.82% 0.4s 0.0s 2.8s
Astral Smolder 75.51% 48.26% 92.34% 14.0s 0.0s 116.0s
Incarnation (Total) 48.70% 43.46% 55.00% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.46% 26.28% 30.99% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.39% 36.25% 50.17% 11.0s 0.0s 15.0s
No Eclipse 5.99% 3.65% 8.13% 1.4s 0.0s 3.5s
Friend of the Fae 43.86% 15.10% 87.74% 25.0s 0.0s 166.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8250.00036.96847.59325.74771.636
Full Moon
New Moon
Half Moon
0.3410.00019.4935.8065.28324.802

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.094.4%57.9349.9%0.000.0%52.9645.7%
Starfire25.0092.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.7040.0%0.000.0%70.1660.0%
New Moon0.020.4%0.274.4%0.000.0%5.7395.2%
Half Moon0.000.0%0.335.7%0.000.0%5.3794.2%
Full Moon0.211.8%3.1126.5%0.080.6%8.3471.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_charged_isolation_3
Nature's BalanceAstral Power99.55199.015.41%2.000.100.05%
Full MoonAstral Power5.31265.337.21%49.930.360.13%
Half MoonAstral Power5.69136.683.71%24.000.000.00%
MoonfireAstral Power14.3686.082.34%6.000.060.07%
New MoonAstral Power6.0272.251.96%12.000.000.00%
Orbit BreakerAstral Power6.41191.365.20%29.841.060.55%
Shooting Stars (Moonfire)Astral Power96.08191.975.22%2.000.190.10%
Shooting Stars (Sunfire)Astral Power96.41192.645.23%2.000.190.10%
StarfireAstral Power27.01395.7310.75%14.652.880.72%
SunfireAstral Power17.40104.402.84%6.000.010.01%
WrathAstral Power117.981845.1550.13%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_charged_isolation_3
StarsurgeAstral Power 117.033692.56100.00%31.5531.608830.01
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 1948.32 2240.91 2362244.7 808215.2 339091.2 896040.0
Astral Power 70.0 12.26 12.28 4.9 23.7 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_charged_isolation_3 Fight Length
Count 21024
Mean 300.16
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.8313
5th Percentile 246.15
95th Percentile 354.09
( 95th Percentile - 5th Percentile ) 107.94
Mean Distribution
Standard Deviation 0.2402
95.00% Confidence Interval ( 299.69 - 300.63 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51729
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1036
DPS
phial_of_charged_isolation_3 Damage Per Second
Count 21024
Mean 247623.56
Minimum 217378.68
Maximum 289907.29
Spread ( max - min ) 72528.61
Range [ ( max - min ) / 2 * 100% ] 14.64%
Standard Deviation 9147.6677
5th Percentile 233235.31
95th Percentile 263113.30
( 95th Percentile - 5th Percentile ) 29877.99
Mean Distribution
Standard Deviation 63.0889
95.00% Confidence Interval ( 247499.91 - 247747.22 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5243
0.1 Scale Factor Error with Delta=300 714340
0.05 Scale Factor Error with Delta=300 2857357
0.01 Scale Factor Error with Delta=300 71433912
Priority Target DPS
phial_of_charged_isolation_3 Priority Target Damage Per Second
Count 21024
Mean 247623.56
Minimum 217378.68
Maximum 289907.29
Spread ( max - min ) 72528.61
Range [ ( max - min ) / 2 * 100% ] 14.64%
Standard Deviation 9147.6677
5th Percentile 233235.31
95th Percentile 263113.30
( 95th Percentile - 5th Percentile ) 29877.99
Mean Distribution
Standard Deviation 63.0889
95.00% Confidence Interval ( 247499.91 - 247747.22 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5243
0.1 Scale Factor Error with Delta=300 714340
0.05 Scale Factor Error with Delta=300 2857357
0.01 Scale Factor Error with Delta=300 71433912
DPS(e)
phial_of_charged_isolation_3 Damage Per Second (Effective)
Count 21024
Mean 247623.56
Minimum 217378.68
Maximum 289907.29
Spread ( max - min ) 72528.61
Range [ ( max - min ) / 2 * 100% ] 14.64%
Damage
phial_of_charged_isolation_3 Damage
Count 21024
Mean 71834472.33
Minimum 53180285.04
Maximum 92193597.61
Spread ( max - min ) 39013312.57
Range [ ( max - min ) / 2 * 100% ] 27.16%
DTPS
phial_of_charged_isolation_3 Damage Taken Per Second
Count 21024
Mean 2242.62
Minimum 860.88
Maximum 4440.30
Spread ( max - min ) 3579.41
Range [ ( max - min ) / 2 * 100% ] 79.80%
HPS
phial_of_charged_isolation_3 Healing Per Second
Count 21024
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_charged_isolation_3 Healing Per Second (Effective)
Count 21024
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_charged_isolation_3 Heal
Count 21024
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_charged_isolation_3 Healing Taken Per Second
Count 21024
Mean 1946.20
Minimum 621.25
Maximum 3992.27
Spread ( max - min ) 3371.02
Range [ ( max - min ) / 2 * 100% ] 86.61%
TMI
phial_of_charged_isolation_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_charged_isolation_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_charged_isolation_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.07 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.06 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.47 starsurge,if=variable.starsurge_condition1
R 15.97 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.11 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.22 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.38 starsurge,if=variable.starsurge_condition2
Y 116.29 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVXYYXRYXYWQQSQYYYYYXYXYOTXYYWQQQRYQYYQYYXYSXYXWQYQPPQYQRYYYYXYYQQPPQSUQVQQRYOYWQQYPPQYQQYYSYRWQQYYFQPPQYYQYYYYQQERSQTUQYYXYPPWQQYYQQRYOYYSXYWQYPPQQYYQRYYYWQQYYQSVQQTYYYRPPQQYQYQYYXOYSYXWYRPPQQYFQNUQYQVQYYYWQQEQRSQYYYYYXYXTYQQQRYYYSYXYOYXYWQQYQPPQYQRUQYYWQQQSYYPPQQYYXRV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 1 food phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 2 augmentation phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 4 no_cd_talent phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 5 on_use_trinket phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 6 on_use_trinket phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 7 on_use_trinket phial_of_charged_isolation_3 50.0/100: 50% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil phial_of_charged_isolation_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.924 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:01.850 st L starfire Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak
0:02.684 st N incarnation_chosen_of_elune Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak
0:02.684 default D potion Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak
0:02.684 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power
0:02.684 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.527 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.337 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.118 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.871 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.627 st U half_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.629 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.384 st V full_moon Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.882 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.637 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.390 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.147 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.900 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.655 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.410 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.164 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.918 st W cancel_buff Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(35)
0:15.918 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.760 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.571 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.349 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.127 st Y wrath Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.881 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.635 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.389 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.144 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.899 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:23.654 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:24.408 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.163 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:25.918 st O warrior_of_elune Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:25.918 st T new_moon Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:26.672 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:27.426 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:28.181 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:28.936 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:28.936 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:29.776 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:30.584 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.363 st R sunfire Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.116 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.871 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:33.627 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:34.383 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:35.137 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:35.892 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:36.648 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:37.403 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:38.158 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:38.911 st S moonfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:39.665 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:40.420 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:41.325 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:42.230 st W cancel_buff Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:42.230 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:43.242 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:44.216 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:45.190 st P starfire Fluffy_Pillow 18.0/100: 18% astral_power denizen_of_the_dream, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:45.944 st P starfire Fluffy_Pillow 34.8/100: 35% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:46.698 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:47.636 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
0:48.611 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
0:49.587 st R sunfire Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:50.562 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:51.537 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:52.611 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:53.683 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:54.757 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
0:55.831 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
0:56.904 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:57.898 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
0:59.011 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:00.082 st P starfire Fluffy_Pillow 15.6/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:01.628 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(2), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:02.471 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:03.409 st S moonfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:04.230 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:05.326 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:06.148 st V full_moon Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:07.789 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:08.695 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:09.602 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:10.507 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:11.261 st O warrior_of_elune Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:11.261 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:12.165 st W cancel_buff Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
1:12.165 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
1:13.257 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
1:14.309 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
1:15.322 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak
1:16.078 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak
1:16.833 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak
1:17.846 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
1:18.823 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
1:19.798 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
1:20.775 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:21.849 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:22.922 st S moonfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:23.995 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:25.070 st R sunfire Fluffy_Pillow 69.2/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:26.146 st W cancel_buff Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:26.146 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:27.348 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
1:28.504 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:29.616 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:30.730 default F natures_vigil phial_of_charged_isolation_3 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:30.730 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:31.843 st P starfire Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:32.598 st P starfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
1:33.477 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
1:34.452 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
1:35.427 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:36.402 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:37.379 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:38.454 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:39.528 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:40.601 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:41.674 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:42.875 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:44.029 default E use_items Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak
1:44.029 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
1:45.040 st S moonfire Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(95)
1:46.052 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(90)
1:47.062 st T new_moon Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(85)
1:47.816 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(85)
1:49.115 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(75)
1:50.092 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(70)
1:51.067 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(65)
1:52.042 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(60)
1:53.018 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(60)
1:53.993 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(55)
1:55.455 st P starfire Fluffy_Pillow 66.0/100: 66% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(45)
1:56.334 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(40)
1:56.334 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(40)
1:57.427 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(35)
1:58.477 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(30)
1:59.232 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(25)
2:00.243 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(20)
2:01.255 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(15)
2:02.329 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(10)
2:03.405 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(5)
2:04.479 st O warrior_of_elune Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:04.479 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:05.552 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:06.626 st S moonfire Fluffy_Pillow 74.0/100: 74% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:07.700 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:08.774 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:09.849 st W cancel_buff Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:09.849 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:11.050 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:12.205 st P starfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:12.960 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:13.714 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
2:14.765 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
2:15.778 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(7), best_friends_with_urctos_static
2:16.754 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(6), best_friends_with_urctos_static
2:17.728 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(5), best_friends_with_urctos_static
2:18.802 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static
2:19.876 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(3), best_friends_with_urctos_static
2:20.952 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
2:22.023 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:23.097 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:23.097 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:24.300 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:25.455 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:26.567 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:27.680 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:28.792 st S moonfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak
2:29.768 st V full_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak
2:31.714 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak
2:32.691 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak
2:33.665 st T new_moon Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:34.419 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:35.396 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:36.373 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:37.346 st R sunfire Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:38.321 st P starfire Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
2:39.958 st P starfire Fluffy_Pillow 100.0/100: 100% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(8), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:40.943 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:42.036 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:43.088 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
2:43.843 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
2:44.856 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:45.833 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
2:46.906 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:47.980 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:49.053 st X starsurge Fluffy_Pillow 38.0/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
2:50.127 st O warrior_of_elune Fluffy_Pillow 4.0/100: 4% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:50.127 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:51.202 st S moonfire Fluffy_Pillow 22.0/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:52.275 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:53.348 st X starsurge Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:54.422 st W cancel_buff Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:54.422 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:55.623 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
2:56.825 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
2:57.578 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
2:58.333 st Q starsurge Fluffy_Pillow 99.6/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
2:59.424 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
3:00.475 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
3:01.487 default F natures_vigil phial_of_charged_isolation_3 51.6/100: 52% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
3:01.487 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
3:02.498 st N incarnation_chosen_of_elune Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
3:02.684 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:03.985 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:04.962 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:05.715 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:06.689 st V full_moon Fluffy_Pillow 13.6/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:08.638 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:09.612 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
3:10.367 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
3:11.343 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
3:12.319 st W cancel_buff Fluffy_Pillow 91.6/100: 92% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
3:12.319 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak
3:13.412 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak
3:14.463 default E use_items Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:14.463 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:15.476 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(95)
3:16.452 st S moonfire Fluffy_Pillow 25.6/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(95)
3:17.427 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(90)
3:18.403 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(85)
3:19.378 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(80)
3:20.352 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(75)
3:21.327 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(70)
3:22.304 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(65)
3:23.281 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(60)
3:24.256 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(55)
3:25.231 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(50)
3:26.206 st T new_moon Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(45)
3:26.960 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(40)
3:27.934 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(35)
3:29.030 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(30)
3:30.081 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(25)
3:31.093 st R sunfire Fluffy_Pillow 1.6/100: 2% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(20)
3:31.998 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(15)
3:32.903 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(10)
3:33.808 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(5)
3:34.712 st S moonfire Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:35.617 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:36.522 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:37.427 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:38.329 st O warrior_of_elune Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:38.329 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:39.235 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:40.139 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:41.044 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:41.044 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:42.058 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:43.031 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:43.969 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:44.905 st P starfire Fluffy_Pillow 17.6/100: 18% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:45.662 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:46.416 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
3:47.392 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
3:48.369 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
3:49.344 st R sunfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak
3:50.231 st U half_moon Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak
3:51.413 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak
3:52.388 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:53.363 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:54.338 st W cancel_buff Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:54.338 st Q starsurge Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:55.433 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:56.483 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
3:57.495 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:58.469 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
3:59.446 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
4:00.421 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
4:01.175 st P starfire Fluffy_Pillow 68.0/100: 68% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
4:02.052 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
4:03.026 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
4:04.000 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
4:04.975 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
4:05.950 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak
4:06.926 st R sunfire Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
4:08.000 st V full_moon Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 16498 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 16498 14916 0
Crit 22.51% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 17158 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_charged_isolation_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_charged_isolation_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_corrupting_rage_3 : 249212 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
249211.9 249211.9 124.4 / 0.050% 36132.1 / 14.5% 19608.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_corrupting_rage_3 249212
Astral Smolder 18035 7.2% 67.5 4.39s 80079 0 Periodic 118.9 45473 0 45473 0.0% 79.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.49 0.00 118.85 118.85 52.24 0.0000 2.0000 5404591.25 5404591.25 0.00% 22736.45 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 118.85 71 161 45473.22 9473 166864 45484.53 33619 60659 5404591 5404591 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7992) 0.0% (3.2%) 8.6 32.34s 277360 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13665 3.2% 153.9 1.73s 15576 12201 Direct 153.0 12159 24295 15671 28.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.91 152.97 0.00 0.00 0.00 1.2766 0.0000 2397222.11 2397222.11 0.00% 12201.03 12201.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.06% 108.71 21 298 12159.23 8060 21116 12150.24 10706 14179 1321779 1321779 0.00%
crit 28.94% 44.27 4 118 24295.34 16198 42232 24282.89 21163 30874 1075443 1075443 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.417
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:17787.31
Hungering Shadowflame 4056 1.6% 17.4 16.60s 69798 0 Direct 17.4 54064 108291 69797 29.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.45 17.45 0.00 0.00 0.00 0.0000 0.0000 1217650.66 1217650.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.98% 12.38 2 26 54063.84 35869 210762 53918.45 36224 124505 669435 669435 0.00%
crit 29.02% 5.06 0 15 108291.45 71739 421524 107167.07 0 421524 548215 548215 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3727 1.5% 34.6 8.56s 32325 0 Direct 34.5 25150 50260 32412 28.9%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.58 34.48 0.00 0.00 0.00 0.0000 0.0000 1117727.27 1117727.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.08% 24.51 8 44 25150.46 24387 28658 25149.89 24682 26245 616423 616423 0.00%
crit 28.92% 9.97 1 24 50259.82 48773 57316 50262.97 49036 55443 501305 501305 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13342 5.4% 14.4 21.60s 278463 289544 Direct 14.4 9602 19687 13241 36.1%
Periodic 313.8 8678 18126 12135 36.6% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.36 14.36 313.76 313.76 13.35 0.9618 0.9518 3997450.58 3997450.58 0.00% 12794.05 289544.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.92% 9.18 1 17 9601.63 6295 18047 9605.25 7893 12935 88109 88109 0.00%
crit 36.08% 5.18 0 14 19687.24 14158 36682 19647.69 0 30736 101961 101961 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.41% 198.97 131 266 8678.24 1068 15957 8682.52 8153 9273 1726689 1726689 0.00%
crit 36.59% 114.79 68 174 18125.72 1503 31913 18135.95 16793 19889 2080691 2080691 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.10
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23632) 0.0% (9.5%) 17.0 17.94s 416232 352652

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.02 0.00 0.00 0.00 0.00 1.1803 0.0000 0.00 0.00 0.00% 352651.89 352651.89

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8670 3.5% 5.3 62.48s 490958 268519 Direct 5.3 338287 663731 493605 47.7%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8286 0.0000 2607315.40 2607315.40 0.00% 268518.58 268518.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.28% 2.76 0 6 338286.73 177254 562077 331510.84 0 541066 934054 934054 0.00%
crit 47.72% 2.52 0 6 663730.80 407513 1116947 639089.29 0 1074309 1673261 1673261 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6405 2.6% 6.0 53.57s 318024 421570 Direct 6.0 206835 432842 319814 50.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.99 0.00 0.00 0.00 0.7545 0.0000 1914349.29 1914349.29 0.00% 421569.98 421569.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.00% 2.99 0 7 206834.86 102756 325842 203521.22 0 320028 619052 619052 0.00%
crit 50.00% 2.99 0 7 432842.06 217422 651683 428799.36 0 630445 1295297 1295297 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8558 3.4% 5.7 57.78s 450363 371350 Direct 5.7 292893 583237 452835 55.1%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2129 0.0000 2564169.68 2564169.68 0.00% 371349.70 371349.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.91% 2.54 0 7 292893.08 159638 466052 282721.90 0 452772 744942 744942 0.00%
crit 55.09% 3.12 0 7 583236.79 295423 932103 576108.76 0 906660 1819228 1819228 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22068) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8239 3.3% 96.1 3.12s 25708 0 Direct 95.8 17205 36121 25779 45.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.10 95.84 0.00 0.00 0.00 0.0000 0.0000 2470627.23 2470627.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.67% 52.40 24 87 17205.39 10130 34480 17210.22 15100 19893 901555 901555 0.00%
crit 45.33% 43.44 19 83 36120.61 20260 68960 36135.66 31177 41993 1569072 1569072 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8252 3.3% 96.4 3.08s 25665 0 Direct 96.1 17185 36061 25736 45.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.40 96.14 0.00 0.00 0.00 0.0000 0.0000 2474184.13 2474184.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.70% 52.59 23 89 17184.76 10130 34480 17189.78 15241 19969 903699 903699 0.00%
crit 45.30% 43.55 19 76 36061.49 20260 68960 36078.77 31747 41542 1570485 1570485 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5577 2.2% 6.4 47.27s 260741 0 Direct 6.4 174058 365208 261520 45.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.39 0.00 0.00 0.00 0.0000 0.0000 1672316.26 1672316.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.24% 3.47 0 9 174058.21 103595 338660 172457.46 0 312671 603719 603719 0.00%
crit 45.76% 2.93 0 8 365207.81 208022 685410 357948.31 0 660227 1068597 1068597 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6042 2.4% 26.0 11.49s 69920 77582 Direct 27.0 47488 94788 67328 41.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.98 26.98 0.00 0.00 0.00 0.9012 0.0000 1816815.58 1816815.58 0.00% 77582.01 77582.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.05% 15.67 4 29 47487.58 20923 92791 47474.90 36064 55696 743901 743901 0.00%
crit 41.95% 11.32 1 24 94787.73 41846 184486 94747.50 67425 123476 1072915 1072915 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.04
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80572 (108829) 32.3% (43.6%) 116.8 2.55s 278951 285550 Direct 116.6 (155.0) 141238 292887 206973 43.3% (43.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.83 116.58 0.00 0.00 0.00 0.9769 0.0000 24128988.90 24128988.90 0.00% 285550.28 285550.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.65% 66.05 34 99 141238.27 92604 274091 141303.18 128333 160140 9328554 9328554 0.00%
crit 43.35% 50.53 26 80 292886.81 171582 548182 293103.66 265892 333726 14800435 14800435 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.46
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.38
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28257 11.3% 38.6 7.65s 219332 0 Direct 38.4 148626 306165 220395 45.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.58 38.39 0.00 0.00 0.00 0.0000 0.0000 8461150.35 8461150.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.44% 20.90 6 41 148625.59 89708 286604 148704.27 121851 183777 3106585 3106585 0.00%
crit 45.56% 17.49 4 35 306164.68 193663 573209 306408.89 246635 385212 5354565 5354565 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13364 5.4% 17.4 18.05s 230281 239793 Direct 17.4 9603 19425 13491 39.6%
Periodic 314.7 8562 17366 11986 38.9% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 314.72 314.72 16.40 0.9604 0.9519 4006933.96 4006933.96 0.00% 12669.07 239792.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.42% 10.51 2 19 9603.10 5690 16674 9593.81 7996 11348 100957 100957 0.00%
crit 39.58% 6.89 0 15 19425.17 11381 33347 19420.93 0 28236 133789 133789 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.11% 192.32 130 256 8562.05 4093 15120 8561.21 8055 9104 1646679 1646679 0.00%
crit 38.89% 122.39 75 174 17366.14 3358 30240 17367.22 16241 18697 2125510 2125510 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.96
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4312) 0.0% (1.7%) 8.6 31.84s 149782 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2244 0.9% 8.6 31.84s 77935 0 Direct 8.6 60487 120897 77933 28.9%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 8.64 0.00 0.00 0.00 0.0000 0.0000 673092.01 673092.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.12% 6.14 0 19 60486.54 58599 68863 60450.69 0 68863 371516 371516 0.00%
crit 28.88% 2.49 0 12 120897.32 117198 137726 111818.74 0 137726 301576 301576 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2069 0.8% 16.7 15.43s 37107 0 Direct 16.7 28767 57486 37104 29.0%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 0.00 0.00 0.00 0.0000 0.0000 620522.38 620522.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.96% 11.87 1 40 28766.94 27883 32767 28763.98 27983 32411 341362 341362 0.00%
crit 29.04% 4.86 0 17 57486.06 55766 65534 56849.98 0 65534 279161 279161 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23812 9.6% 118.0 2.49s 60486 64509 Direct 117.5 40268 83043 60716 47.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.96 117.52 0.00 0.00 0.00 0.9376 0.0000 7134996.06 7134996.06 0.00% 64509.39 64509.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.20% 61.34 34 93 40267.76 15445 126778 40274.96 35091 45922 2469994 2469994 0.00%
crit 47.80% 56.18 31 86 83042.61 30891 256474 83069.95 71933 97191 4665002 4665002 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.28

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_corrupting_rage_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 192.44s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 71.81s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35466.09
  • base_dd_max:35466.09
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.34s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.42s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.20s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.07
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.15% 29.13% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.2s
  • trigger_min/max:2.7s / 51.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.19% / 27.97%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.78% 54.76% 3.0 (17.8) 17.8

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.3s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.1s
  • uptime_min/max:45.56% / 54.48%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.03%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.37%
  • balance_of_all_things_nature_6:6.52%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.0 44.2s 4.1s 20.2s 48.61% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:0.8s / 42.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.73% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.36%
  • balance_t31_4pc_buff_lunar_3:4.89%
  • balance_t31_4pc_buff_lunar_4:5.62%
  • balance_t31_4pc_buff_lunar_5:29.13%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.8 22.0s 2.6s 19.3s 90.57% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.0s
  • trigger_min/max:0.8s / 11.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.22% / 93.54%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.52%
  • balance_t31_4pc_buff_solar_2:11.47%
  • balance_t31_4pc_buff_solar_3:15.96%
  • balance_t31_4pc_buff_solar_4:11.68%
  • balance_t31_4pc_buff_solar_5:43.94%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.5s 70.5s 10.8s 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.3s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.41%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.8s 70.5s 45.7s 33.10% 0.00% 68.7 (68.7) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 354.3s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.10%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.6s 70.6s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 346.2s
  • trigger_min/max:12.0s / 346.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.25%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.8s 70.6s 45.9s 33.52% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.3s
  • trigger_min/max:12.0s / 346.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.52%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.5s 70.5s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.8s
  • trigger_min/max:12.0s / 341.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.24%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.4s 70.5s 45.7s 33.38% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 348.7s
  • trigger_min/max:12.0s / 341.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 290.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.38%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.6s 50.3s 80.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:44.57% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.26%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 44.8s 31.6s 41.4s 57.84% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 266.1s
  • trigger_min/max:0.0s / 150.5s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 248.7s
  • uptime_min/max:19.42% / 97.53%

Stack Uptimes

  • denizen_of_the_dream_1:38.81%
  • denizen_of_the_dream_2:14.57%
  • denizen_of_the_dream_3:3.67%
  • denizen_of_the_dream_4:0.68%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.30% 20.62% 0.7 (1.4) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s
  • uptime_min/max:8.95% / 26.08%

Stack Uptimes

  • dreamstate_1:9.48%
  • dreamstate_2:5.82%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.6s 44.2s 20.6s 49.62% 52.74% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.12% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.62%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.8s 20.1s 93.09% 96.26% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.4s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.53% / 95.42%

Stack Uptimes

  • eclipse_solar_1:93.09%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.22% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.22%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.1s 31.6s 25.0s 43.90% 43.86% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 197.9s
  • trigger_min/max:0.0s / 150.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 134.7s
  • uptime_min/max:12.95% / 81.86%

Stack Uptimes

  • friend_of_the_fae_1:43.90%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.2s 48.71% 51.48% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.37% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.71%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.34% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.9s
  • trigger_min/max:90.0s / 124.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.38% / 26.45%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.50% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.3s
  • trigger_min/max:12.8s / 70.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.96% / 31.06%

Stack Uptimes

  • natures_grace_1:25.50%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.0s 67.9s 7.7s 6.38% 7.07% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 352.6s
  • trigger_min/max:0.0s / 352.6s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 29.7s
  • uptime_min/max:0.00% / 29.78%

Stack Uptimes

  • owlkin_frenzy_1:6.38%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.6 38.3s 38.3s 34.3s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:23.7s / 49.4s
  • trigger_min/max:23.7s / 49.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.5s
  • uptime_min/max:90.31% / 96.88%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.25%
  • primordial_arcanic_pulsar_12:6.74%
  • primordial_arcanic_pulsar_16:6.79%
  • primordial_arcanic_pulsar_20:6.56%
  • primordial_arcanic_pulsar_24:6.06%
  • primordial_arcanic_pulsar_28:6.91%
  • primordial_arcanic_pulsar_32:8.31%
  • primordial_arcanic_pulsar_36:6.62%
  • primordial_arcanic_pulsar_40:7.17%
  • primordial_arcanic_pulsar_44:7.34%
  • primordial_arcanic_pulsar_48:6.86%
  • primordial_arcanic_pulsar_52:7.70%
  • primordial_arcanic_pulsar_56:6.77%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.70% 39.91% 3.7 (3.7) 18.3

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:35.88% / 42.66%

Stack Uptimes

  • solstice_1:39.70%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.0 14.7s 2.6s 14.1s 97.33% 0.00% 54.9 (54.9) 7.6

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 11.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.65% / 99.09%

Stack Uptimes

  • starlord_1:9.21%
  • starlord_2:14.75%
  • starlord_3:73.37%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.8s 5.5s 43.2s 90.18% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:70.22% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.7s 45.3s 16.5s 23.75% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 222.9s
  • trigger_min/max:0.0s / 216.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 87.1s
  • uptime_min/max:4.77% / 63.80%

Stack Uptimes

  • wafting_devotion_1:23.75%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.80% 42.93% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.1s
  • trigger_min/max:45.0s / 82.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.48% / 51.55%

Stack Uptimes

  • warrior_of_elune_1:20.37%
  • warrior_of_elune_2:5.33%
  • warrior_of_elune_3:18.10%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 23.0 31.6s 0.0s 150.4s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 29.2s 51.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.66% 0.4s 0.0s 2.8s
Astral Smolder 79.45% 57.28% 93.22% 15.6s 0.0s 122.0s
Incarnation (Total) 48.71% 43.37% 55.00% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.47% 26.21% 30.93% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.38% 36.42% 50.45% 11.0s 0.0s 15.0s
No Eclipse 5.98% 3.46% 8.38% 1.4s 0.0s 3.6s
Friend of the Fae 43.90% 12.95% 81.86% 25.0s 0.0s 134.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8520.00038.43647.71625.95770.964
Full Moon
New Moon
Half Moon
0.3410.00023.6385.8035.28929.249

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.104.4%57.9149.9%0.000.0%52.9545.7%
Starfire24.9892.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.7040.0%0.000.0%70.1360.0%
New Moon0.020.4%0.264.4%0.000.0%5.7495.3%
Half Moon0.000.0%0.335.8%0.000.0%5.3694.2%
Full Moon0.201.7%3.1226.6%0.080.7%8.3271.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_corrupting_rage_3
Nature's BalanceAstral Power99.52198.945.41%2.000.100.05%
Full MoonAstral Power5.31265.147.21%49.930.370.14%
Half MoonAstral Power5.69136.663.71%24.000.000.00%
MoonfireAstral Power14.3586.062.34%6.000.070.08%
New MoonAstral Power6.0272.231.96%12.000.000.00%
Orbit BreakerAstral Power6.41191.325.20%29.831.080.56%
Shooting Stars (Moonfire)Astral Power96.10192.005.22%2.000.200.10%
Shooting Stars (Sunfire)Astral Power96.41192.615.23%2.000.210.11%
StarfireAstral Power26.99395.4110.75%14.652.940.74%
SunfireAstral Power17.40104.392.84%6.000.010.01%
WrathAstral Power117.961844.7850.14%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_corrupting_rage_3
StarsurgeAstral Power 117.013691.91100.00%31.5531.608827.45
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 4119.46 4911.89 1756810.5 658255.1 -580321.9 896040.0
Astral Power 70.0 12.26 12.28 5.0 23.2 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_corrupting_rage_3 Fight Length
Count 21058
Mean 300.07
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.6991
5th Percentile 245.81
95th Percentile 353.98
( 95th Percentile - 5th Percentile ) 108.17
Mean Distribution
Standard Deviation 0.2391
95.00% Confidence Interval ( 299.60 - 300.54 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 514
0.1% Error 51367
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1028
DPS
phial_of_corrupting_rage_3 Damage Per Second
Count 21058
Mean 249211.94
Minimum 217167.77
Maximum 293570.68
Spread ( max - min ) 76402.91
Range [ ( max - min ) / 2 * 100% ] 15.33%
Standard Deviation 9206.8048
5th Percentile 234630.06
95th Percentile 264827.06
( 95th Percentile - 5th Percentile ) 30196.99
Mean Distribution
Standard Deviation 63.4454
95.00% Confidence Interval ( 249087.59 - 249336.29 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5243
0.1 Scale Factor Error with Delta=300 723605
0.05 Scale Factor Error with Delta=300 2894420
0.01 Scale Factor Error with Delta=300 72360497
Priority Target DPS
phial_of_corrupting_rage_3 Priority Target Damage Per Second
Count 21058
Mean 249211.94
Minimum 217167.77
Maximum 293570.68
Spread ( max - min ) 76402.91
Range [ ( max - min ) / 2 * 100% ] 15.33%
Standard Deviation 9206.8048
5th Percentile 234630.06
95th Percentile 264827.06
( 95th Percentile - 5th Percentile ) 30196.99
Mean Distribution
Standard Deviation 63.4454
95.00% Confidence Interval ( 249087.59 - 249336.29 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5243
0.1 Scale Factor Error with Delta=300 723605
0.05 Scale Factor Error with Delta=300 2894420
0.01 Scale Factor Error with Delta=300 72360497
DPS(e)
phial_of_corrupting_rage_3 Damage Per Second (Effective)
Count 21058
Mean 249211.94
Minimum 217167.77
Maximum 293570.68
Spread ( max - min ) 76402.91
Range [ ( max - min ) / 2 * 100% ] 15.33%
Damage
phial_of_corrupting_rage_3 Damage
Count 21058
Mean 72282881.00
Minimum 54137080.86
Maximum 93775500.60
Spread ( max - min ) 39638419.74
Range [ ( max - min ) / 2 * 100% ] 27.42%
DTPS
phial_of_corrupting_rage_3 Damage Taken Per Second
Count 21058
Mean 4912.29
Minimum 1215.71
Maximum 9927.12
Spread ( max - min ) 8711.42
Range [ ( max - min ) / 2 * 100% ] 88.67%
HPS
phial_of_corrupting_rage_3 Healing Per Second
Count 21058
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_corrupting_rage_3 Healing Per Second (Effective)
Count 21058
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_corrupting_rage_3 Heal
Count 21058
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_corrupting_rage_3 Healing Taken Per Second
Count 21058
Mean 4106.46
Minimum 928.95
Maximum 8039.17
Spread ( max - min ) 7110.22
Range [ ( max - min ) / 2 * 100% ] 86.57%
TMI
phial_of_corrupting_rage_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_corrupting_rage_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_corrupting_rage_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.07 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.04 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.46 starsurge,if=variable.starsurge_condition1
R 15.96 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.10 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.38 starsurge,if=variable.starsurge_condition2
Y 116.28 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTUQQYQVXYRXYXYSWQQYQYYYYXYXOTYXQYYYWQQQRYYYYXYSXYYXXYPPQQRYQYYXYYXYPPQQSUQRQVOYYXXYPPQQYQYSYRYXYXFYYPPQQYQYYYYXRXSYPPQEQQTQUOYQYYXRYPPWQQSYQYYYYXYYXYWQPPQJYQYYYSXYYWQQYQRQQVOTXYXPPYQQYSQYYRYYXXFYPNUQQVQQQYYQRSYYYWQQQYEYYYYXTXYYXRYWQQSQYYOXYYXXYYPPWQQQRUQYYYYSXXPPYQQYYQRYYYXYXPPQSYQYYQROYYYYXFWQVQQTQYYYXSXPPWQQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_corrupting_rage_3 50.0/100: 50% astral_power
Pre precombat 1 food phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket phial_of_corrupting_rage_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil phial_of_corrupting_rage_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.926 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.852 st L starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.684 st N incarnation_chosen_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.684 default D potion Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.684 default E use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.684 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.524 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.334 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.114 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.868 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.868 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:07.622 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.376 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.132 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:09.885 st V full_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.386 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.141 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.895 st R sunfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.651 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.405 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.159 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.914 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.670 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.424 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.424 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.266 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.075 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.854 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.634 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.388 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.142 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.897 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.652 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:24.408 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.164 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.918 st O warrior_of_elune Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.918 st T new_moon Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.672 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.427 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:28.181 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:28.934 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.689 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:30.445 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.200 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.200 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.042 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.853 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:33.632 st R sunfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:34.387 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:35.143 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:35.896 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:36.651 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:37.406 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:38.160 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:38.915 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:39.669 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:40.422 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:41.396 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:42.371 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:43.347 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:44.322 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:45.296 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:46.049 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:46.804 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:47.897 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:48.948 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:49.960 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:50.971 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:52.085 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:53.159 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:54.232 st X starsurge Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:55.307 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:56.380 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:57.453 st X starsurge Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:58.526 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:59.599 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:01.207 st P starfire Fluffy_Pillow 35.6/100: 36% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:02.085 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:03.177 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:04.229 st S moonfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:05.147 st U half_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:06.371 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:07.291 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:08.268 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:09.243 st V full_moon Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:11.191 st O warrior_of_elune Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:11.191 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:11.947 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:12.923 st X starsurge Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:13.900 st X starsurge Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:14.875 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:15.850 st P starfire Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:16.605 st P starfire Fluffy_Pillow 72.4/100: 72% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:17.359 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:18.453 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:19.503 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:20.515 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:21.525 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:22.598 st S moonfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:23.672 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:24.745 st R sunfire Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:25.818 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:26.891 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:27.964 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:29.039 st X starsurge Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.114 default F natures_vigil phial_of_corrupting_rage_3 27.2/100: 27% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:30.114 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:31.189 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:32.263 st P starfire Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
1:33.017 st P starfire Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), best_friends_with_pip_static, corrupting_rage
1:34.000 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
1:35.093 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:36.142 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:37.155 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:38.167 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:39.240 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:40.313 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:41.387 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:42.462 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:43.536 st R sunfire Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:44.610 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:45.683 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:46.757 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:47.830 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:49.438 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:50.423 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:51.516 default E use_items Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:51.516 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:52.472 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:53.393 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:54.148 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:55.034 st U half_moon Fluffy_Pillow 2.0/100: 2% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
1:56.334 st O warrior_of_elune Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:56.334 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:57.091 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:58.067 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:59.041 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
2:00.016 st X starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
2:00.991 st R sunfire Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
2:01.967 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
2:02.873 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
2:03.627 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
2:04.382 st W cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
2:04.382 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
2:05.394 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
2:06.367 st S moonfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
2:07.304 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
2:08.242 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
2:09.178 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
2:10.171 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
2:11.166 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
2:12.160 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:13.154 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:14.146 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:15.142 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:16.135 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:17.130 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.202 st W cancel_buff Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.202 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:19.404 st P starfire Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:20.157 st P starfire Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:21.102 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:22.153 st J sunfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:23.165 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:24.176 st Q starsurge Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:25.188 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:26.263 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:27.335 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:28.409 st S moonfire Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:29.483 st X starsurge Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:30.556 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:31.629 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:32.703 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:32.703 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.903 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:34.955 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:35.967 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:36.980 st R sunfire Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:37.955 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:38.931 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:39.907 st V full_moon Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
2:41.856 st O warrior_of_elune Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
2:41.856 st T new_moon Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
2:42.612 st X starsurge Fluffy_Pillow 68.4/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
2:43.587 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
2:44.563 st X starsurge Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
2:45.538 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power denizen_of_the_dream, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:46.292 st P starfire Fluffy_Pillow 49.2/100: 49% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:47.045 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:48.021 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:49.114 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
2:50.164 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:51.176 st S moonfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:52.288 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:53.399 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:54.472 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.546 st R sunfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.621 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.693 st Y wrath Fluffy_Pillow 74.0/100: 74% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.766 st X starsurge Fluffy_Pillow 92.0/100: 92% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:59.839 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
3:00.913 default F natures_vigil phial_of_corrupting_rage_3 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:00.913 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:01.985 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:02.738 st N incarnation_chosen_of_elune Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:02.738 st U half_moon Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:03.922 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:04.914 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:05.868 st V full_moon Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:07.705 st Q starsurge Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
3:08.714 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
3:09.690 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
3:10.665 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
3:11.421 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
3:12.176 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
3:13.152 st R sunfire Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:14.128 st S moonfire Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:15.103 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:16.078 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:17.054 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:17.959 st W cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:17.959 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:18.971 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:19.945 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.883 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:21.787 default E use_items Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:21.787 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:22.693 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:23.598 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
3:24.501 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
3:25.406 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
3:26.308 st T new_moon Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
3:27.063 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
3:27.968 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
3:28.873 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
3:29.777 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
3:30.683 st R sunfire Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:31.589 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:32.493 st W cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
3:32.493 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
3:33.586 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
3:34.636 st S moonfire Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
3:35.647 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:36.658 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:37.633 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:38.609 st O warrior_of_elune Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:38.609 st X starsurge Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:39.585 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:40.560 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:41.534 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:42.508 st X starsurge Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:43.483 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.461 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:45.437 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.192 st P starfire Fluffy_Pillow 69.6/100: 70% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.946 st W cancel_buff Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.946 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.038 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.992 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:49.913 st R sunfire Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:50.802 st U half_moon Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:52.100 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.075 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:54.051 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.025 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.002 st Y wrath Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.977 st S moonfire Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:57.953 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:58.929 st X starsurge Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:59.905 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:00.660 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:01.539 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:02.514 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_urctos_static, corrupting_rage
4:03.607 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:04.658 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:05.670 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:06.781 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:07.894 st R sunfire Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:08.969 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:10.042 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:11.115 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:12.188 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:13.263 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
4:14.337 st X starsurge Fluffy_Pillow 61.2/100: 61% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
4:15.412 st P starfire Fluffy_Pillow 27.2/100: 27% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
4:17.019 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
4:17.898 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
4:18.991 st S moonfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
4:20.041 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:20.796 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:21.846 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:22.858 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:23.970 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:25.083 st R sunfire Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:26.155 st O warrior_of_elune Fluffy_Pillow 15.2/100: 15% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:26.155 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:27.227 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:28.301 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:29.375 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:30.448 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.443 default F natures_vigil phial_of_corrupting_rage_3 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.443 st W cancel_buff Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.443 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.557 st V full_moon Fluffy_Pillow 17.2/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:34.501 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:35.474 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.413 st T new_moon Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.166 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:38.069 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:38.975 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.878 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:40.783 st X starsurge Fluffy_Pillow 59.2/100: 59% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:41.689 st S moonfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:42.594 st X starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:43.498 st P starfire Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:44.254 st P starfire Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:45.009 st W cancel_buff Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
4:45.009 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
4:46.100 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 28.72% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_corrupting_rage_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_elemental_chaos_3 : 246907 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
246907.0 246907.0 123.4 / 0.050% 35674.6 / 14.4% 19309.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.3 Astral Power 0.00% 67.8 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_elemental_chaos_3 246907
Astral Smolder 16892 6.8% 62.3 4.74s 81401 0 Periodic 114.7 44182 0 44182 0.0% 76.4%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.25 0.00 114.69 114.69 46.34 0.0000 2.0000 5067421.57 5067421.57 0.00% 22091.05 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 114.69 70 160 44182.17 9473 167290 44187.98 32968 57375 5067422 5067422 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7944) 0.0% (3.2%) 8.7 31.82s 273461 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13538 3.2% 156.2 1.70s 15284 12058 Direct 155.2 12329 24594 15380 24.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.20 155.23 0.00 0.00 0.00 1.2676 0.0000 2387391.99 2387391.99 0.00% 12057.84 12057.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.13% 116.61 23 316 12329.01 8235 21640 12317.90 10784 14675 1437760 1437760 0.00%
crit 24.87% 38.61 4 118 24593.88 17784 42629 24584.42 21726 30054 949632 949632 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.061
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:15443.50
Hungering Shadowflame 4007 1.6% 17.7 16.45s 68231 0 Direct 17.7 54591 109170 68229 25.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.65 17.65 0.00 0.00 0.00 0.0000 0.0000 1204348.82 1204348.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.01% 13.24 3 31 54591.47 35869 215988 54423.30 36178 119534 722838 722838 0.00%
crit 24.99% 4.41 0 15 109169.74 71739 431977 107806.21 0 415907 481511 481511 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3732 1.5% 35.5 8.29s 31582 0 Direct 35.4 25333 50875 31669 24.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.48 35.38 0.00 0.00 0.00 0.0000 0.0000 1120487.86 1120487.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.20% 26.61 9 51 25333.40 24387 29369 25333.15 24684 26590 674027 674027 0.00%
crit 24.80% 8.78 0 22 50875.19 48773 59277 50870.73 0 57316 446461 446461 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13228 5.4% 14.4 21.59s 276050 288945 Direct 14.4 9756 20175 13140 32.5%
Periodic 316.5 8784 18475 11939 32.6% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 316.53 316.53 13.37 0.9554 0.9446 3968076.64 3968076.64 0.00% 12688.63 288944.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.53% 9.71 2 17 9755.94 6259 18413 9761.20 8167 12603 94694 94694 0.00%
crit 32.47% 4.67 0 12 20175.46 12876 36990 20112.11 0 32553 94182 94182 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 67.43% 213.45 145 285 8783.55 116 16352 8787.46 8225 9373 1874858 1874858 0.00%
crit 32.57% 103.08 61 151 18474.67 3582 32705 18485.19 17065 20194 1904342 1904342 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.11
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23457) 0.0% (9.5%) 17.1 17.91s 412951 352114

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.05 0.00 0.00 0.00 0.00 1.1728 0.0000 0.00 0.00 0.00% 352114.30 352114.30

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8605 3.5% 5.3 62.26s 486683 268210 Direct 5.3 344614 677438 489402 43.5%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 5.29 0.00 0.00 0.00 1.8147 0.0000 2590375.49 2590375.49 0.00% 268210.34 268210.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.50% 2.99 0 6 344614.40 201907 578365 339898.06 0 555584 1030513 1030513 0.00%
crit 43.50% 2.30 0 6 677438.38 390795 1174938 640181.81 0 1113846 1559863 1559863 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.37
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6332 2.6% 6.0 53.40s 314378 416747 Direct 6.0 209887 441877 316039 45.8%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 6.00 0.00 0.00 0.00 0.7545 0.0000 1895363.40 1895363.40 0.00% 416746.57 416746.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.24% 3.25 0 7 209887.03 102756 327918 207870.06 0 327750 682722 682722 0.00%
crit 45.76% 2.74 0 7 441876.60 222106 666815 434184.77 0 650066 1212641 1212641 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.04
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8519 3.5% 5.7 57.61s 448348 371375 Direct 5.7 298780 596737 450660 51.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.67 0.00 0.00 0.00 1.2074 0.0000 2556547.14 2556547.14 0.00% 371375.24 371375.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.02% 2.78 0 7 298780.22 160121 479592 291519.10 0 449296 830885 830885 0.00%
crit 50.98% 2.89 0 7 596736.93 336511 959184 584592.08 0 918776 1725662 1725662 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.73
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22112) 0.0% (9.0%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8243 3.3% 97.0 3.09s 25521 0 Direct 96.7 17527 37044 25589 41.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.96 96.70 0.00 0.00 0.00 0.0000 0.0000 2474552.16 2474552.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.69% 56.76 28 97 17527.39 10130 35012 17531.57 15319 19829 994803 994803 0.00%
crit 41.31% 39.94 18 72 37044.18 20260 70339 37063.43 32432 44100 1479749 1479749 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8269 3.4% 97.4 3.07s 25492 0 Direct 97.1 17511 36981 25561 41.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.39 97.12 0.00 0.00 0.00 0.0000 0.0000 2482583.04 2482583.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.65% 56.97 27 95 17510.60 10130 35482 17514.01 15280 20097 997547 997547 0.00%
crit 41.35% 40.16 14 70 36981.15 20260 70927 36998.59 31214 43667 1485036 1485036 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5599 2.3% 6.5 46.85s 259778 0 Direct 6.5 177615 375531 260532 41.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.47 6.45 0.00 0.00 0.00 0.0000 0.0000 1680884.44 1680884.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.10% 3.75 0 9 177615.28 102287 341031 176925.01 0 331889 665692 665692 0.00%
crit 41.90% 2.70 0 8 375530.79 207189 699118 363886.48 0 652541 1015192 1015192 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5897 2.4% 25.9 11.56s 68663 76231 Direct 26.9 47893 96018 66108 37.8%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.86 26.86 0.00 0.00 0.00 0.9007 0.0000 1775955.40 1775955.40 0.00% 76231.08 76231.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.15% 16.70 5 29 47893.22 20923 96796 47878.35 38928 57421 799671 799671 0.00%
crit 37.85% 10.17 1 22 96018.18 41846 188291 95984.11 52786 128876 976285 976285 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:24.91
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80274 (108406) 32.5% (43.9%) 117.7 2.54s 276253 284694 Direct 117.4 (156.0) 143646 299639 205003 39.3% (39.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.66 117.41 0.00 0.00 0.00 0.9704 0.0000 24068588.58 24068588.58 0.00% 284693.56 284693.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.67% 71.23 44 102 143646.01 87417 282054 143701.83 130122 158797 10231585 10231585 0.00%
crit 39.33% 46.18 20 76 299638.92 185208 564108 299893.29 266757 335879 13837003 13837003 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.92
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.74
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28131 11.4% 38.8 7.69s 217299 0 Direct 38.6 151069 313066 218333 41.5%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.82 38.64 0.00 0.00 0.00 0.0000 0.0000 8435444.05 8435444.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.48% 22.59 7 44 151069.42 96832 294931 151116.29 125181 179620 3413257 3413257 0.00%
crit 41.52% 16.04 3 32 313066.13 193663 582045 313294.16 254935 416339 5022187 5022187 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13246 5.4% 17.4 18.04s 228255 239102 Direct 17.4 9721 19825 13291 35.3%
Periodic 317.5 8660 17662 11795 34.8% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.42 17.42 317.49 317.49 16.42 0.9546 0.9446 3976271.36 3976271.36 0.00% 12561.47 239102.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.67% 11.27 3 20 9721.46 5690 17087 9712.79 8170 11657 109523 109523 0.00%
crit 35.33% 6.15 0 15 19824.58 11381 34174 19814.99 0 28879 122010 122010 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.18% 206.94 143 277 8660.32 518 15495 8659.30 8166 9222 1792166 1792166 0.00%
crit 34.82% 110.55 66 172 17661.83 2837 30523 17663.29 16535 19181 1952573 1952573 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.43
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.99
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4245) 0.0% (1.7%) 8.7 31.50s 146424 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.71 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2213 0.9% 8.7 31.50s 76321 0 Direct 8.7 60927 122370 76316 25.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.71 8.71 0.00 0.00 0.00 0.0000 0.0000 664647.32 664647.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.95% 6.53 0 19 60927.47 58599 70571 60915.25 0 70571 397655 397655 0.00%
crit 25.05% 2.18 0 10 122369.71 117198 141142 109345.86 0 141142 266992 266992 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2032 0.8% 16.9 15.30s 36227 0 Direct 16.9 28975 58196 36227 24.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.85 16.85 0.00 0.00 0.00 0.0000 0.0000 610499.48 610499.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.18% 12.67 2 37 28974.79 27883 33580 28973.03 28016 31330 367104 367104 0.00%
crit 24.82% 4.18 0 17 58195.85 55766 67159 57057.96 0 67159 243396 243396 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23742 9.6% 119.3 2.46s 59680 64013 Direct 118.9 40702 84537 59911 43.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.33 118.87 0.00 0.00 0.00 0.9323 0.0000 7121712.24 7121712.24 0.00% 64013.09 64013.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.18% 66.78 36 102 40702.38 15445 128797 40710.58 36025 46338 2718264 2718264 0.00%
crit 43.82% 52.09 27 81 84536.53 30891 255688 84572.07 72550 99605 4403448 4403448 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:117.66

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_elemental_chaos_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Elemental Chaos 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 194.20s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.31s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.57s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.46s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.05
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 9.1 1.2 34.6s 33.3s 8.3s 25.35% 29.30% 1.2 (6.7) 8.9

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:2.6s / 50.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.35% / 28.24%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.97%
  • balance_of_all_things_arcane_2:2.99%
  • balance_of_all_things_arcane_3:3.03%
  • balance_of_all_things_arcane_4:3.06%
  • balance_of_all_things_arcane_5:3.08%
  • balance_of_all_things_arcane_6:3.32%
  • balance_of_all_things_arcane_7:3.44%
  • balance_of_all_things_arcane_8:3.45%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.7 2.7 16.4s 14.2s 8.2s 51.03% 55.05% 2.7 (16.3) 18.1

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:45.35% / 54.65%

Stack Uptimes

  • balance_of_all_things_nature_1:6.04%
  • balance_of_all_things_nature_2:6.09%
  • balance_of_all_things_nature_3:6.18%
  • balance_of_all_things_nature_4:6.27%
  • balance_of_all_things_nature_5:6.39%
  • balance_of_all_things_nature_6:6.53%
  • balance_of_all_things_nature_7:6.67%
  • balance_of_all_things_nature_8:6.87%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.4 43.8s 4.1s 20.1s 48.79% 0.00% 35.2 (35.2) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:0.8s / 42.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.03% / 54.99%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.60%
  • balance_t31_4pc_buff_lunar_2:4.40%
  • balance_t31_4pc_buff_lunar_3:4.84%
  • balance_t31_4pc_buff_lunar_4:5.69%
  • balance_t31_4pc_buff_lunar_5:29.25%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 103.7 22.1s 2.5s 19.5s 90.70% 0.00% 49.9 (49.9) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:86.60% / 93.49%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.39%
  • balance_t31_4pc_buff_solar_2:11.25%
  • balance_t31_4pc_buff_solar_3:15.85%
  • balance_t31_4pc_buff_solar_4:11.57%
  • balance_t31_4pc_buff_solar_5:44.64%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.9s 69.9s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.1s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.63%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.0s 69.9s 45.8s 33.37% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.2s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.37%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 347.8s
  • trigger_min/max:12.0s / 347.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.29%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.8s 70.4s 45.8s 33.32% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 356.6s
  • trigger_min/max:12.0s / 347.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.32%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.5s 70.5s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 335.8s
  • trigger_min/max:12.0s / 335.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.14%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.7s 70.5s 45.5s 33.31% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 356.7s
  • trigger_min/max:12.0s / 335.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.31%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.50% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Denizen of the Dream 8.7 0.0 44.8s 31.4s 41.5s 58.04% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 283.1s
  • trigger_min/max:0.0s / 145.8s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 265.8s
  • uptime_min/max:18.68% / 96.51%

Stack Uptimes

  • denizen_of_the_dream_1:38.71%
  • denizen_of_the_dream_2:14.79%
  • denizen_of_the_dream_3:3.73%
  • denizen_of_the_dream_4:0.71%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.1 0.8 20.5s 20.6s 2.9s 14.75% 20.27% 0.8 (1.6) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.7s
  • uptime_min/max:8.50% / 26.34%

Stack Uptimes

  • dreamstate_1:9.18%
  • dreamstate_2:5.57%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.2s 43.8s 20.5s 49.77% 52.80% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.77%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.4 22.3s 15.8s 20.2s 93.20% 96.28% 5.4 (5.4) 12.9

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.1s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.8s
  • uptime_min/max:90.45% / 95.49%

Stack Uptimes

  • eclipse_solar_1:93.20%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.3s 98.8s 58.1s 25.10% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 339.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_air_1:25.10%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.8s 99.8s 58.1s 24.90% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 331.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_earth_1:24.91%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.9s 99.0s 57.9s 24.86% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_fire_1:24.86%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.6s 98.9s 58.1s 25.14% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_frost_1:25.14%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.3s 13.23% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.23%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.1s 31.4s 25.1s 44.12% 44.04% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 196.5s
  • trigger_min/max:0.0s / 145.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 127.8s
  • uptime_min/max:14.68% / 87.68%

Stack Uptimes

  • friend_of_the_fae_1:44.12%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 43.8s 43.8s 20.2s 48.87% 51.53% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 54.99%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.87%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 98.7s 98.7s 19.5s 23.38% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 123.1s
  • trigger_min/max:90.0s / 123.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.33% / 26.56%

Stack Uptimes

  • kindled_soul_5:1.12%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.16%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.44% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.3s
  • trigger_min/max:12.8s / 70.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.44% / 30.70%

Stack Uptimes

  • natures_grace_1:25.44%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 73.3s 67.3s 7.7s 6.46% 7.16% 0.1 (0.1) 1.4

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 342.8s
  • trigger_min/max:0.0s / 342.8s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 34.9s
  • uptime_min/max:0.00% / 26.98%

Stack Uptimes

  • owlkin_frenzy_1:6.46%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.3 110.3 38.1s 38.1s 34.1s 94.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 49.8s
  • trigger_min/max:24.2s / 49.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.8s
  • uptime_min/max:90.80% / 96.86%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.06%
  • primordial_arcanic_pulsar_8:5.12%
  • primordial_arcanic_pulsar_12:6.79%
  • primordial_arcanic_pulsar_16:6.89%
  • primordial_arcanic_pulsar_20:6.51%
  • primordial_arcanic_pulsar_24:6.00%
  • primordial_arcanic_pulsar_28:6.77%
  • primordial_arcanic_pulsar_32:8.23%
  • primordial_arcanic_pulsar_36:6.67%
  • primordial_arcanic_pulsar_40:7.20%
  • primordial_arcanic_pulsar_44:7.36%
  • primordial_arcanic_pulsar_48:6.81%
  • primordial_arcanic_pulsar_52:7.73%
  • primordial_arcanic_pulsar_56:6.95%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.9 3.5 16.4s 14.2s 6.3s 39.80% 40.04% 3.5 (3.5) 18.4

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.3s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s
  • uptime_min/max:35.59% / 42.68%

Stack Uptimes

  • solstice_1:39.80%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.9 96.8 14.6s 2.5s 14.0s 97.42% 0.00% 55.5 (55.5) 7.5

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.86% / 99.08%

Stack Uptimes

  • starlord_1:9.09%
  • starlord_2:14.64%
  • starlord_3:73.68%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.4 47.9s 5.5s 43.2s 90.17% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.5s
  • uptime_min/max:72.90% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.17%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.70% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 222.2s
  • trigger_min/max:0.0s / 214.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.8s
  • uptime_min/max:4.46% / 59.74%

Stack Uptimes

  • wafting_devotion_1:23.70%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.5s 49.5s 21.8s 43.81% 42.83% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.38% / 51.30%

Stack Uptimes

  • warrior_of_elune_1:20.58%
  • warrior_of_elune_2:5.37%
  • warrior_of_elune_3:17.86%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 24.0 31.4s 0.0s 145.8s
Primordial Arcanic Pulsar 7.3 6.0 9.0 39.8s 28.7s 50.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.52% 0.4s 0.0s 2.7s
Astral Smolder 76.59% 55.37% 92.70% 14.5s 0.0s 108.0s
Incarnation (Total) 48.87% 43.34% 54.99% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.65% 26.07% 31.22% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.90% 0.69% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.33% 36.48% 50.29% 11.1s 0.0s 15.0s
No Eclipse 5.88% 3.57% 8.56% 1.4s 0.0s 3.6s
Friend of the Fae 44.12% 14.68% 87.68% 25.1s 0.0s 127.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune8.0860.00036.92049.01626.37074.287
Full Moon
New Moon
Half Moon
0.3390.00022.2995.7765.20227.913

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.114.4%58.9850.3%0.000.0%53.2445.4%
Starfire24.8692.5%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%47.0640.0%0.000.0%70.6060.0%
New Moon0.010.2%0.264.3%0.000.0%5.7695.5%
Half Moon0.000.0%0.305.2%0.000.0%5.4094.8%
Full Moon0.201.7%3.0826.2%0.070.6%8.4371.5%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_elemental_chaos_3
Nature's BalanceAstral Power99.64199.185.37%2.000.100.05%
Full MoonAstral Power5.32265.717.17%49.930.390.15%
Half MoonAstral Power5.70136.863.69%24.000.000.00%
MoonfireAstral Power14.3786.182.33%6.000.060.07%
New MoonAstral Power6.0372.351.95%12.000.000.00%
Orbit BreakerAstral Power6.47193.045.21%29.831.070.55%
Shooting Stars (Moonfire)Astral Power96.96193.745.23%2.000.190.10%
Shooting Stars (Sunfire)Astral Power97.38194.585.25%2.000.190.10%
StarfireAstral Power26.87393.1910.61%14.642.740.69%
SunfireAstral Power17.42104.512.82%6.000.010.01%
WrathAstral Power119.331866.6650.37%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_elemental_chaos_3
StarsurgeAstral Power 117.843718.68100.00%31.5631.618740.75
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 1964.42 2259.63 2306262.7 807352.1 397548.7 896040.0
Astral Power 70.0 12.34 12.36 4.7 23.1 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_elemental_chaos_3 Fight Length
Count 20567
Mean 300.41
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.97%
Standard Deviation 34.5785
5th Percentile 246.30
95th Percentile 354.26
( 95th Percentile - 5th Percentile ) 107.96
Mean Distribution
Standard Deviation 0.2411
95.00% Confidence Interval ( 299.94 - 300.89 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50895
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1021
DPS
phial_of_elemental_chaos_3 Damage Per Second
Count 20567
Mean 246907.03
Minimum 212263.26
Maximum 287751.85
Spread ( max - min ) 75488.58
Range [ ( max - min ) / 2 * 100% ] 15.29%
Standard Deviation 9025.7982
5th Percentile 232686.97
95th Percentile 262177.56
( 95th Percentile - 5th Percentile ) 29490.59
Mean Distribution
Standard Deviation 62.9361
95.00% Confidence Interval ( 246783.68 - 247030.39 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5134
0.1 Scale Factor Error with Delta=300 695433
0.05 Scale Factor Error with Delta=300 2781730
0.01 Scale Factor Error with Delta=300 69543239
Priority Target DPS
phial_of_elemental_chaos_3 Priority Target Damage Per Second
Count 20567
Mean 246907.03
Minimum 212263.26
Maximum 287751.85
Spread ( max - min ) 75488.58
Range [ ( max - min ) / 2 * 100% ] 15.29%
Standard Deviation 9025.7982
5th Percentile 232686.97
95th Percentile 262177.56
( 95th Percentile - 5th Percentile ) 29490.59
Mean Distribution
Standard Deviation 62.9361
95.00% Confidence Interval ( 246783.68 - 247030.39 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5134
0.1 Scale Factor Error with Delta=300 695433
0.05 Scale Factor Error with Delta=300 2781730
0.01 Scale Factor Error with Delta=300 69543239
DPS(e)
phial_of_elemental_chaos_3 Damage Per Second (Effective)
Count 20567
Mean 246907.03
Minimum 212263.26
Maximum 287751.85
Spread ( max - min ) 75488.58
Range [ ( max - min ) / 2 * 100% ] 15.29%
Damage
phial_of_elemental_chaos_3 Damage
Count 20567
Mean 71693758.98
Minimum 53612808.55
Maximum 92490558.45
Spread ( max - min ) 38877749.90
Range [ ( max - min ) / 2 * 100% ] 27.11%
DTPS
phial_of_elemental_chaos_3 Damage Taken Per Second
Count 20567
Mean 2260.54
Minimum 762.76
Maximum 4482.23
Spread ( max - min ) 3719.47
Range [ ( max - min ) / 2 * 100% ] 82.27%
HPS
phial_of_elemental_chaos_3 Healing Per Second
Count 20567
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_elemental_chaos_3 Healing Per Second (Effective)
Count 20567
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_elemental_chaos_3 Heal
Count 20567
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_elemental_chaos_3 Healing Taken Per Second
Count 20567
Mean 1961.66
Minimum 581.82
Maximum 4381.39
Spread ( max - min ) 3799.57
Range [ ( max - min ) / 2 * 100% ] 96.85%
TMI
phial_of_elemental_chaos_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_elemental_chaos_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_elemental_chaos_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.43 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.05 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 24.91 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.92 starsurge,if=variable.starsurge_condition1
R 15.99 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.11 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.04 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.73 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.37 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.44 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.74 starsurge,if=variable.starsurge_condition2
Y 117.66 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTUQVQYYXYRXYYWQQQSYXYYXYYXYTOXYYXYWQQRQYYQYYYYSXYXXYYPPQQYQRYYYYXYXYPPQQSYYQRUQVOYXYWQQYPPQQSYQRYYYFWQYQYYPPQQYQYYYRSQQYYQETUQYQYYOYYWQQPPQJQSYYYYXYYWQQYPPQRYQYQYYXYSQYQVQQRQTYYYXPOPQQYQYYSYYXRYXYWQFPPQNUQYQQVQYYWQQQRSYYYXYEXYYXYWQQQTYYRYYXSYXOYWQQYQYYPPQQUQRYXYYQQQSYPPQYQYYQYRYYQQYYPPQQSYYYYWQQRQQVFOQTYXXYYPPQQSYQRUYYXXYEWYPP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_elemental_chaos_3 50.0/100: 50% astral_power
Pre precombat 1 food phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 2 augmentation phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 4 no_cd_talent phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 5 on_use_trinket phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 6 on_use_trinket phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 7 on_use_trinket phial_of_elemental_chaos_3 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power elemental_chaos_air
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power elemental_chaos_air
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, elemental_chaos_air
0:00.000 default F natures_vigil phial_of_elemental_chaos_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, elemental_chaos_air
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, elemental_chaos_air
0:00.898 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, elemental_chaos_air
0:01.796 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, elemental_chaos_air
0:02.605 st N incarnation_chosen_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, elemental_chaos_air
0:02.605 default D potion Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_chaos_air
0:02.605 default E use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:02.605 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.422 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.205 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(95)
0:04.961 st T new_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.715 st U half_moon Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.687 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(80)
0:07.444 st V full_moon Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.899 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(70)
0:09.654 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.409 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.165 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.921 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.677 st R sunfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.432 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.184 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.938 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.692 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(35)
0:15.692 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.509 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.293 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.049 st S moonfire Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.803 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.556 st X starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.310 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.065 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.819 st X starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.575 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.330 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:24.083 st X starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:24.838 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:25.592 st T new_moon Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:26.347 st O warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:26.347 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:27.103 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:27.858 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:28.612 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:29.368 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:30.121 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:30.121 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:30.940 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:31.724 st R sunfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:32.481 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air, elemental_potion_of_ultimate_power
0:33.237 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:33.993 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:34.747 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:35.501 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:36.258 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:37.011 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:37.765 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:38.520 st S moonfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:39.274 st X starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_chaos_air
0:40.028 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:40.974 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:41.919 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:42.865 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:43.811 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_chaos_air
0:44.757 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, elemental_chaos_air
0:45.511 st P starfire Fluffy_Pillow 68.8/100: 69% astral_power natures_grace, primordial_arcanic_pulsar(28), warrior_of_elune(2), undulating_sporecloak, elemental_chaos_air
0:46.266 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, undulating_sporecloak, elemental_chaos_air
0:47.326 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak, elemental_chaos_air
0:48.345 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, elemental_chaos_air
0:49.327 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, elemental_chaos_air
0:50.310 st R sunfire Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), elemental_chaos_air
0:51.256 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), elemental_chaos_air
0:52.300 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), elemental_chaos_air
0:53.340 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), elemental_chaos_air
0:54.382 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), elemental_chaos_air
0:55.423 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, elemental_chaos_air
0:56.464 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), undulating_sporecloak, elemental_chaos_air
0:57.505 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
0:58.547 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
0:59.588 st P starfire Fluffy_Pillow 45.6/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
1:01.149 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:02.027 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:03.118 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:04.168 st S moonfire Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:05.180 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:05.934 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:06.946 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:08.058 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:09.032 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:10.332 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:11.307 st V full_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:13.253 st O warrior_of_elune Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:13.253 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:14.228 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:15.203 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:16.176 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:16.176 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:17.269 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:18.319 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:19.329 st P starfire Fluffy_Pillow 35.6/100: 36% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:20.085 st P starfire Fluffy_Pillow 52.4/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:20.840 st Q starsurge Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:21.850 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:22.825 st S moonfire Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:23.800 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:24.775 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:25.750 st R sunfire Fluffy_Pillow 1.2/100: 1% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:26.824 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:27.896 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:28.890 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:29.883 default F natures_vigil phial_of_elemental_chaos_3 57.2/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:30.000 st W cancel_buff Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:30.000 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:31.114 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:32.185 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:33.255 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:34.287 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:35.318 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:36.073 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:36.917 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:37.856 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:38.761 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:39.665 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_frost
1:40.568 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_frost
1:41.473 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_frost
1:42.466 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_frost
1:43.461 st R sunfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, elemental_chaos_frost
1:44.535 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, elemental_chaos_frost
1:45.608 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:46.810 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:47.967 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:49.077 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:50.189 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:51.302 default E use_items Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost
1:51.302 st T new_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(100)
1:52.056 st U half_moon Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(100)
1:53.357 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(90)
1:54.333 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(85)
1:55.309 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(80)
1:56.285 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(80)
1:57.262 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(75)
1:58.237 st O warrior_of_elune Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(70)
1:58.253 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(70)
1:59.230 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_frost, kindled_soul(65)
2:00.207 st W cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(60)
2:00.207 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(60)
2:01.267 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(55)
2:02.285 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(50)
2:03.039 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(45)
2:03.794 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(40)
2:04.775 st J sunfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(35)
2:05.721 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(30)
2:06.667 st S moonfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(25)
2:07.614 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(20)
2:08.561 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(15)
2:09.603 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(10)
2:10.645 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air, kindled_soul(5)
2:11.686 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:12.728 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:13.769 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:14.811 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:14.811 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:15.977 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:17.097 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_air
2:18.177 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:18.931 st P starfire Fluffy_Pillow 46.4/100: 46% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:19.754 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:20.669 st R sunfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:21.551 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:22.431 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:23.312 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:24.194 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:25.163 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:26.131 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:27.100 st X starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:28.069 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:29.038 st S moonfire Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:30.008 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:31.094 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:32.137 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:33.181 st V full_moon Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:35.006 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:35.921 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:36.804 st R sunfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:37.684 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:38.566 st T new_moon Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:39.318 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:40.201 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:41.081 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:41.962 st X starsurge Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_air
2:42.841 st P starfire Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:44.259 st O warrior_of_elune Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:44.259 st P starfire Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:45.014 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:46.074 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:47.094 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:47.849 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:48.832 st Y wrath Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:49.778 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:50.725 st S moonfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:51.766 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:52.807 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:53.849 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:54.892 st R sunfire Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:55.933 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:56.974 st X starsurge Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:58.014 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:59.057 st W cancel_buff Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
2:59.057 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(36), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, elemental_chaos_air
3:00.221 default F natures_vigil phial_of_elemental_chaos_3 19.2/100: 19% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune(2), dreamstate(2), best_friends_with_pip_static, elemental_chaos_earth
3:00.221 st P starfire Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune(2), dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:00.975 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, best_friends_with_pip_static, elemental_chaos_earth
3:01.730 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_pip_static, elemental_chaos_earth
3:02.780 st N incarnation_chosen_of_elune Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, elemental_chaos_earth
3:02.780 st U half_moon Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate(2), best_friends_with_pip_static, elemental_chaos_earth
3:04.005 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate(2), best_friends_with_pip_static, elemental_chaos_earth
3:04.927 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:05.681 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:06.657 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:07.632 st V full_moon Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:09.579 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, elemental_chaos_earth
3:10.555 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:11.310 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:12.214 st W cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:12.214 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:13.227 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:14.201 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:15.141 st R sunfire Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:16.046 st S moonfire Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:16.950 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:17.855 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:18.761 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:19.664 st X starsurge Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:20.568 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:21.472 default E use_items Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:21.472 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(100)
3:22.377 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(100)
3:23.281 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(95)
3:24.186 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(90)
3:25.091 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(85)
3:25.997 st W cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(80)
3:25.997 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(80)
3:27.009 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(75)
3:27.983 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(70)
3:28.919 st T new_moon Fluffy_Pillow 0.8/100: 1% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(65)
3:29.673 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(60)
3:30.578 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(55)
3:31.483 st R sunfire Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(50)
3:32.386 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(50)
3:33.289 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(45)
3:34.195 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth, kindled_soul(40)
3:35.101 st S moonfire Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(35)
3:36.075 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(30)
3:37.050 st X starsurge Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(25)
3:38.024 st O warrior_of_elune Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(20)
3:38.024 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(20)
3:38.999 st W cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(15)
3:38.999 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(15)
3:40.091 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(10)
3:41.140 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_earth, kindled_soul(5)
3:42.150 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_earth
3:43.161 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_earth
3:44.136 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:45.042 st P starfire Fluffy_Pillow 40.8/100: 41% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:45.795 st P starfire Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:46.549 st Q starsurge Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:47.455 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:48.278 st U half_moon Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:49.373 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:50.194 st R sunfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:51.017 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:51.924 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:52.827 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:53.733 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:54.637 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:55.650 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:56.623 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:57.559 st S moonfire Fluffy_Pillow 6.4/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:58.465 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
3:59.370 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_earth
4:00.124 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:00.940 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:01.843 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:02.749 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:03.655 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:04.560 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:05.555 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:06.548 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:07.622 st R sunfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:08.617 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:09.611 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:10.605 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:11.718 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:12.789 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:13.820 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:14.852 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:16.398 st P starfire Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:17.241 st Q starsurge Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:18.179 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:19.082 st S moonfire Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:19.986 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:20.741 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:21.644 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_chaos_fire
4:22.548 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:23.623 st W cancel_buff Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:23.623 st Q starsurge Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:24.825 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:25.981 st R sunfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:26.993 st Q starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:28.004 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:28.980 st V full_moon Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:30.927 default F natures_vigil phial_of_elemental_chaos_3 69.2/100: 69% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:30.927 st O warrior_of_elune Fluffy_Pillow 69.2/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:30.927 st Q starsurge Fluffy_Pillow 69.2/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:31.902 st T new_moon Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:32.656 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:33.631 st X starsurge Fluffy_Pillow 75.2/100: 75% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:34.605 st X starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:35.581 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_chaos_fire
4:36.556 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:37.532 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:38.286 st P starfire Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:39.039 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:40.133 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:41.184 st S moonfire Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:42.198 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:43.210 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:44.323 st R sunfire Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:45.395 st U half_moon Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:46.873 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:47.947 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:49.022 st X starsurge Fluffy_Pillow 80.8/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:50.095 st X starsurge Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:51.169 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:52.244 default E use_items Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire
4:52.244 st W cancel_buff Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire, kindled_soul(100)
4:52.244 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire, kindled_soul(100)
4:53.446 st P starfire Fluffy_Pillow 42.8/100: 43% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire, kindled_soul(95)
4:54.200 st P starfire Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), best_friends_with_urctos_static, undulating_sporecloak, elemental_chaos_fire, kindled_soul(95)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 22.51% 22.51% 3151
Haste 29.14% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_elemental_chaos_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_static_empowerment_3 : 248013 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
248012.9 248012.9 123.9 / 0.050% 36038.0 / 14.5% 19511.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_static_empowerment_3 248013
Astral Smolder 16788 6.8% 60.3 4.89s 83337 0 Periodic 112.9 44537 0 44537 0.0% 75.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.34 0.00 112.91 112.91 44.16 0.0000 2.0000 5028727.22 5028727.22 0.00% 22269.43 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 112.91 67 157 44536.74 9555 157024 44543.08 32027 56992 5028727 5028727 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (8038) 0.0% (3.2%) 8.7 31.58s 277052 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13728 3.2% 154.7 1.69s 15576 12199 Direct 153.8 12652 25263 15672 24.0%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.75 153.79 0.00 0.00 0.00 1.2768 0.0000 2410362.37 2410362.37 0.00% 12198.75 12198.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.05% 116.96 24 326 12651.75 8268 21401 12640.70 11339 15345 1479704 1479704 0.00%
crit 23.95% 36.84 3 97 25262.71 16536 42803 25246.47 22239 30385 930658 930658 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.095
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:18245.25
Hungering Shadowflame 3900 1.6% 17.5 16.44s 66953 0 Direct 17.5 54152 107461 66957 24.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.48 17.48 0.00 0.00 0.00 0.0000 0.0000 1170457.65 1170457.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.98% 13.28 3 28 54152.32 35869 210762 53974.72 36299 120140 719181 719181 0.00%
crit 24.02% 4.20 0 14 107460.51 71739 421524 105728.07 0 421524 451277 451277 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3647 1.5% 35.2 8.43s 31089 0 Direct 35.1 25153 50256 31171 24.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.17 35.08 0.00 0.00 0.00 0.0000 0.0000 1093497.08 1093497.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.03% 26.67 9 49 25152.85 24387 28658 25152.00 24691 26294 670851 670851 0.00%
crit 23.97% 8.41 0 22 50256.05 48773 57316 50247.09 0 55131 422646 422646 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13348 5.4% 14.3 21.60s 278679 289741 Direct 14.3 9968 20488 13246 31.2%
Periodic 313.7 9025 18877 12141 31.6% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 313.66 313.66 13.35 0.9618 0.9519 3998131.31 3998131.31 0.00% 12800.00 289740.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.84% 9.88 2 17 9968.30 6531 18887 9970.52 8204 13170 98454 98454 0.00%
crit 31.16% 4.47 0 12 20487.88 13062 37362 20383.73 0 34008 91583 91583 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.37% 214.46 147 282 9024.98 57 16431 9029.48 8537 9666 1935491 1935491 0.00%
crit 31.63% 99.20 59 150 18877.47 1678 32863 18889.32 17460 21125 1872603 1872603 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.09
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23626) 0.0% (9.5%) 17.0 17.94s 416021 352239

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 0.00 0.00 0.00 1.1811 0.0000 0.00 0.00 0.00% 352238.77 352238.77

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8669 3.5% 5.3 62.42s 490190 267896 Direct 5.3 349610 685841 493036 42.7%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 5.29 0.00 0.00 0.00 1.8299 0.0000 2606357.18 2606357.18 0.00% 267895.69 267895.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.34% 3.03 0 6 349609.75 199875 571645 345247.05 0 551214 1059780 1059780 0.00%
crit 42.66% 2.25 0 6 685841.17 406873 1143290 645413.91 0 1107310 1546577 1546577 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.37
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6384 2.6% 6.0 53.54s 317356 420634 Direct 6.0 214490 448499 319186 44.7%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.98 0.00 0.00 0.00 0.7545 0.0000 1907994.09 1907994.09 0.00% 420633.62 420633.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.26% 3.30 0 7 214490.48 106654 335851 212608.80 0 324230 708476 708476 0.00%
crit 44.74% 2.67 0 7 448499.17 213308 673554 438957.32 0 656051 1199518 1199518 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8573 3.5% 5.7 57.86s 450930 371918 Direct 5.7 303015 602231 453349 50.3%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.67 0.00 0.00 0.00 1.2126 0.0000 2568465.82 2568465.82 0.00% 371918.02 371918.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.75% 2.82 0 7 303015.49 160908 479073 295749.44 0 467326 854008 854008 0.00%
crit 50.25% 2.85 0 7 602230.69 333125 956275 590612.83 0 945101 1714458 1714458 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22099) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8248 3.3% 96.0 3.10s 25761 0 Direct 95.7 17899 37575 25831 40.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.98 95.72 0.00 0.00 0.00 0.0000 0.0000 2472545.05 2472545.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.69% 57.13 27 94 17898.86 10569 35506 17906.55 15894 20536 1022655 1022655 0.00%
crit 40.31% 38.59 13 72 37574.78 21138 71012 37593.24 32378 44578 1449890 1449890 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8263 3.3% 96.3 3.09s 25721 0 Direct 96.0 17875 37528 25791 40.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.29 96.03 0.00 0.00 0.00 0.0000 0.0000 2476653.76 2476653.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.72% 57.35 27 97 17874.60 10390 35506 17880.73 15697 20801 1025105 1025105 0.00%
crit 40.28% 38.68 16 69 37527.81 20779 71012 37546.46 32816 44650 1451549 1451549 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5588 2.3% 6.4 47.23s 261898 0 Direct 6.4 181293 380468 262633 40.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.40 6.38 0.00 0.00 0.00 0.0000 0.0000 1675247.97 1675247.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.16% 3.77 0 9 181293.09 104911 353953 180678.40 0 318097 684127 684127 0.00%
crit 40.84% 2.61 0 8 380467.70 209822 717048 366673.75 0 653926 991121 991121 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6052 2.4% 26.0 11.50s 70101 77857 Direct 27.0 49372 98419 67501 37.0%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.95 26.95 0.00 0.00 0.00 0.9004 0.0000 1819207.34 1819207.34 0.00% 77857.03 77857.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.04% 16.99 5 31 49371.80 21831 97015 49370.08 39427 58269 838786 838786 0.00%
crit 36.96% 9.96 1 22 98419.06 43661 192672 98361.95 65408 125929 980422 980422 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.00
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80719 (109061) 32.5% (43.9%) 116.8 2.55s 279601 286194 Direct 116.5 (154.9) 146919 304298 207368 38.4% (39.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.78 116.53 0.00 0.00 0.00 0.9770 0.0000 24163979.65 24163979.65 0.00% 286193.90 286193.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.59% 71.77 43 101 146919.24 96620 282247 147000.36 134527 163213 10544145 10544145 0.00%
crit 38.41% 44.76 20 70 304297.76 191224 564493 304542.87 269346 351078 13619835 13619835 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.38
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.40
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28342 11.4% 38.6 7.59s 219849 0 Direct 38.4 154412 318061 220914 40.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.60 38.42 0.00 0.00 0.00 0.0000 0.0000 8487024.20 8487024.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.36% 22.81 5 45 154411.57 101032 295133 154477.31 129701 185463 3521490 3521490 0.00%
crit 40.64% 15.61 3 34 318060.63 202063 590265 318318.54 257007 405399 4965535 4965535 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13381 5.4% 17.4 18.04s 230531 240029 Direct 17.4 9967 20258 13529 34.6%
Periodic 314.6 8896 18045 12000 33.9% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 314.61 314.61 16.40 0.9605 0.9519 4010890.65 4010890.65 0.00% 12685.02 240029.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.39% 11.38 3 20 9967.39 5740 17170 9957.38 8457 11965 113395 113395 0.00%
crit 34.61% 6.02 0 14 20257.55 11479 34844 20250.77 0 31382 121993 121993 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.07% 207.87 146 274 8896.45 379 15551 8895.77 8424 9444 1849292 1849292 0.00%
crit 33.93% 106.75 58 158 18044.91 7628 31103 18046.70 16902 19378 1926211 1926211 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.96
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4153) 0.0% (1.7%) 8.7 31.02s 143923 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2163 0.9% 8.7 31.02s 74957 0 Direct 8.7 60502 120891 74954 23.9%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.65 8.65 0.00 0.00 0.00 0.0000 0.0000 648670.48 648670.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.06% 6.58 0 18 60501.57 58599 68863 60475.90 0 68863 398243 398243 0.00%
crit 23.94% 2.07 0 11 120890.83 117198 137726 106501.22 0 137726 250427 250427 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1990 0.8% 16.7 15.10s 35648 0 Direct 16.7 28774 57485 35648 23.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 0.00 0.00 0.00 0.0000 0.0000 596819.49 596819.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.06% 12.73 1 34 28774.03 27883 32767 28771.94 28016 32110 366391 366391 0.00%
crit 23.94% 4.01 0 15 57484.87 55766 65534 56198.45 0 65534 230429 230429 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23920 9.6% 118.0 2.49s 60740 64777 Direct 117.5 41875 86411 60969 42.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.96 117.52 0.00 0.00 0.00 0.9377 0.0000 7165056.19 7165056.19 0.00% 64777.07 64777.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.13% 67.13 40 99 41875.43 15579 132629 41883.89 36339 48038 2811269 2811269 0.00%
crit 42.87% 50.38 27 79 86411.08 31158 264032 86444.51 74282 100789 4353788 4353788 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.28

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_static_empowerment_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 191.51s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.90s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.24s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.06
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.13% 29.11% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:2.7s / 50.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:21.94% / 28.08%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.94%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.76% 54.73% 3.0 (17.8) 17.8

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.3s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:45.77% / 54.51%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.02%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.36%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.88%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.9 44.3s 4.1s 20.2s 48.60% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:0.8s / 42.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.89% / 54.99%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.35%
  • balance_t31_4pc_buff_lunar_3:4.88%
  • balance_t31_4pc_buff_lunar_4:5.60%
  • balance_t31_4pc_buff_lunar_5:29.16%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.8 22.0s 2.6s 19.4s 90.55% 0.00% 49.1 (49.1) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 57.9s
  • trigger_min/max:0.8s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:86.95% / 93.13%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.51%
  • balance_t31_4pc_buff_solar_2:11.46%
  • balance_t31_4pc_buff_solar_3:15.95%
  • balance_t31_4pc_buff_solar_4:11.65%
  • balance_t31_4pc_buff_solar_5:43.98%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 348.8s
  • trigger_min/max:12.0s / 348.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.93%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.6s 70.2s 45.5s 33.14% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 350.8s
  • trigger_min/max:12.0s / 348.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.14%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 9.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 343.4s
  • trigger_min/max:12.0s / 343.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.93%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.1s 70.4s 45.8s 33.25% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.9s / 352.6s
  • trigger_min/max:12.0s / 343.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 304.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.25%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.3s 70.3s 10.8s 10.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 332.4s
  • trigger_min/max:12.0s / 332.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.65%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.2s 70.3s 46.0s 33.61% 0.00% 70.0 (70.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.7s
  • trigger_min/max:12.0s / 332.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 295.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.61%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Denizen of the Dream 8.7 0.0 44.9s 31.4s 41.5s 57.89% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 275.3s
  • trigger_min/max:0.0s / 144.3s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 291.4s
  • uptime_min/max:19.33% / 99.05%

Stack Uptimes

  • denizen_of_the_dream_1:38.55%
  • denizen_of_the_dream_2:14.79%
  • denizen_of_the_dream_3:3.73%
  • denizen_of_the_dream_4:0.71%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.24% 20.60% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:8.04% / 27.15%

Stack Uptimes

  • dreamstate_1:9.41%
  • dreamstate_2:5.83%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.2s 20.6s 49.61% 52.73% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.16% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.61%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.5 22.3s 15.8s 20.2s 93.08% 96.25% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.5s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.66% / 95.15%

Stack Uptimes

  • eclipse_solar_1:93.08%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.22% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.22%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.3s 31.4s 25.1s 44.02% 43.97% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 199.5s
  • trigger_min/max:0.0s / 144.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 141.1s
  • uptime_min/max:14.76% / 89.64%

Stack Uptimes

  • friend_of_the_fae_1:44.02%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.3s 48.70% 51.48% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.41% / 54.99%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.70%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.35% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.4s
  • trigger_min/max:90.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.40% / 26.33%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.46% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.6s
  • trigger_min/max:12.8s / 70.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.82% / 30.83%

Stack Uptimes

  • natures_grace_1:25.46%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.4s 68.1s 7.8s 6.46% 7.15% 0.1 (0.1) 1.4

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 342.9s
  • trigger_min/max:0.0s / 342.9s
  • trigger_pct:15.06%
  • duration_min/max:0.0s / 28.3s
  • uptime_min/max:0.00% / 26.59%

Stack Uptimes

  • owlkin_frenzy_1:6.46%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.5 38.3s 38.3s 34.3s 94.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.7s / 50.1s
  • trigger_min/max:22.7s / 50.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.6s
  • uptime_min/max:89.83% / 96.84%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.00%
  • primordial_arcanic_pulsar_8:5.24%
  • primordial_arcanic_pulsar_12:6.74%
  • primordial_arcanic_pulsar_16:6.78%
  • primordial_arcanic_pulsar_20:6.59%
  • primordial_arcanic_pulsar_24:6.05%
  • primordial_arcanic_pulsar_28:6.91%
  • primordial_arcanic_pulsar_32:8.30%
  • primordial_arcanic_pulsar_36:6.63%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:7.34%
  • primordial_arcanic_pulsar_48:6.84%
  • primordial_arcanic_pulsar_52:7.72%
  • primordial_arcanic_pulsar_56:6.75%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.69% 39.90% 3.7 (3.7) 18.2

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.8s
  • uptime_min/max:35.89% / 42.55%

Stack Uptimes

  • solstice_1:39.69%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.0 14.7s 2.6s 14.1s 97.33% 0.00% 54.8 (54.8) 7.7

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.3s
  • trigger_min/max:0.8s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.94% / 99.12%

Stack Uptimes

  • starlord_1:9.21%
  • starlord_2:14.76%
  • starlord_3:73.37%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.2 47.9s 5.5s 43.1s 90.14% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 340.0s
  • trigger_min/max:5.0s / 45.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.3s
  • uptime_min/max:72.45% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.14%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.8s 45.5s 16.5s 23.72% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 232.3s
  • trigger_min/max:0.0s / 223.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.7s
  • uptime_min/max:4.89% / 58.98%

Stack Uptimes

  • wafting_devotion_1:23.72%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.82% 42.94% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.1s
  • trigger_min/max:45.0s / 82.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.47% / 51.34%

Stack Uptimes

  • warrior_of_elune_1:20.43%
  • warrior_of_elune_2:5.24%
  • warrior_of_elune_3:18.16%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 22.0 31.4s 0.0s 144.3s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 28.7s 50.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.59% 0.4s 0.0s 3.5s
Astral Smolder 75.49% 55.21% 95.06% 14.0s 0.0s 112.0s
Incarnation (Total) 48.70% 43.41% 54.99% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.45% 26.47% 30.93% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.38% 36.50% 50.68% 11.0s 0.0s 15.0s
No Eclipse 5.99% 3.27% 8.30% 1.4s 0.0s 3.5s
Friend of the Fae 44.02% 14.76% 89.64% 25.1s 0.0s 141.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8390.00038.43847.62326.36173.926
Full Moon
New Moon
Half Moon
0.3410.00022.8325.8065.28328.443

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.144.4%57.8649.9%0.000.0%52.9745.7%
Starfire24.9492.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.6840.0%0.000.0%70.1060.0%
New Moon0.020.4%0.264.4%0.000.0%5.7395.2%
Half Moon0.000.0%0.335.8%0.000.0%5.3694.2%
Full Moon0.211.8%3.1126.5%0.070.6%8.3371.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_static_empowerment_3
Nature's BalanceAstral Power99.50198.895.41%2.000.100.05%
Full MoonAstral Power5.32265.467.22%49.930.370.14%
Half MoonAstral Power5.70136.713.72%24.000.000.00%
MoonfireAstral Power14.3586.022.34%6.000.060.07%
New MoonAstral Power6.0172.151.96%12.000.000.00%
Orbit BreakerAstral Power6.40190.835.19%29.831.060.55%
Shooting Stars (Moonfire)Astral Power95.98191.765.21%2.000.200.10%
Shooting Stars (Sunfire)Astral Power96.29192.375.23%2.000.200.10%
StarfireAstral Power26.95394.9710.74%14.652.900.73%
SunfireAstral Power17.40104.382.84%6.000.010.01%
WrathAstral Power117.961844.6050.15%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_static_empowerment_3
StarsurgeAstral Power 116.953690.08100.00%31.5531.608848.31
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 1947.49 2242.94 2361644.3 807408.2 399638.3 896040.0
Astral Power 70.0 12.26 12.28 4.9 23.6 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_static_empowerment_3 Fight Length
Count 21212
Mean 299.99
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6970
5th Percentile 246.26
95th Percentile 353.80
( 95th Percentile - 5th Percentile ) 107.54
Mean Distribution
Standard Deviation 0.2382
95.00% Confidence Interval ( 299.52 - 300.46 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 514
0.1% Error 51390
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1028
DPS
phial_of_static_empowerment_3 Damage Per Second
Count 21212
Mean 248012.95
Minimum 216192.14
Maximum 289365.55
Spread ( max - min ) 73173.41
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 9208.7505
5th Percentile 233491.41
95th Percentile 263778.97
( 95th Percentile - 5th Percentile ) 30287.56
Mean Distribution
Standard Deviation 63.2281
95.00% Confidence Interval ( 247889.03 - 248136.87 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5297
0.1 Scale Factor Error with Delta=300 723911
0.05 Scale Factor Error with Delta=300 2895644
0.01 Scale Factor Error with Delta=300 72391084
Priority Target DPS
phial_of_static_empowerment_3 Priority Target Damage Per Second
Count 21212
Mean 248012.95
Minimum 216192.14
Maximum 289365.55
Spread ( max - min ) 73173.41
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 9208.7505
5th Percentile 233491.41
95th Percentile 263778.97
( 95th Percentile - 5th Percentile ) 30287.56
Mean Distribution
Standard Deviation 63.2281
95.00% Confidence Interval ( 247889.03 - 248136.87 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5297
0.1 Scale Factor Error with Delta=300 723911
0.05 Scale Factor Error with Delta=300 2895644
0.01 Scale Factor Error with Delta=300 72391084
DPS(e)
phial_of_static_empowerment_3 Damage Per Second (Effective)
Count 21212
Mean 248012.95
Minimum 216192.14
Maximum 289365.55
Spread ( max - min ) 73173.41
Range [ ( max - min ) / 2 * 100% ] 14.75%
Damage
phial_of_static_empowerment_3 Damage
Count 21212
Mean 71889725.14
Minimum 53205594.85
Maximum 93375087.27
Spread ( max - min ) 40169492.43
Range [ ( max - min ) / 2 * 100% ] 27.94%
DTPS
phial_of_static_empowerment_3 Damage Taken Per Second
Count 21212
Mean 2243.97
Minimum 863.37
Maximum 4471.72
Spread ( max - min ) 3608.35
Range [ ( max - min ) / 2 * 100% ] 80.40%
HPS
phial_of_static_empowerment_3 Healing Per Second
Count 21212
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_static_empowerment_3 Healing Per Second (Effective)
Count 21212
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_static_empowerment_3 Heal
Count 21212
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_static_empowerment_3 Healing Taken Per Second
Count 21212
Mean 1944.57
Minimum 496.86
Maximum 4089.88
Spread ( max - min ) 3593.02
Range [ ( max - min ) / 2 * 100% ] 92.39%
TMI
phial_of_static_empowerment_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_static_empowerment_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_static_empowerment_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.06 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.00 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.38 starsurge,if=variable.starsurge_condition1
R 15.96 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.09 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.37 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.17 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.40 starsurge,if=variable.starsurge_condition2
Y 116.28 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTUQQVYXYYXRYXYSWQQYQYYYYXYYOXTXYYXWQQQRYQYYQYYSYXYXYWQPPQYQRYQYYYYXYWQYQPPQSUQRVXOYYWQQQPPQYYQYQSYRYWQQFYYPPQYQYQYYYYQQERSQTUQYYYXPOPWQQYYQRYYYXSXYYWQPPQQYYQYRYYYXYWQPPQSQVQQTYRYWQPOPQYQYYQYYSYWQQRYPPQYFQYNQUYWQQVQQQYQRSEQYYYYYQQQYTYYXYYRXYXSYQOQQYYYXYPPQQUXRYQQYQSYYPPQQYYYYWQQRYQYYPPQSYYWQQYYQORYYYFXQVTWQQQYYYSXPPQQEJYYWQQYYQUYPPQRXDS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_static_empowerment_3 50.0/100: 50% astral_power
Pre precombat 1 food phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 2 augmentation phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 4 no_cd_talent phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 5 on_use_trinket phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 6 on_use_trinket phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 7 on_use_trinket phial_of_static_empowerment_3 50.0/100: 50% astral_power static_empowerment
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power static_empowerment
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power static_empowerment
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power static_empowerment
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, static_empowerment
0:00.000 default F natures_vigil phial_of_static_empowerment_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, static_empowerment
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, static_empowerment
0:00.924 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, static_empowerment
0:01.850 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, static_empowerment(2)
0:02.683 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, static_empowerment(3)
0:02.683 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, static_empowerment(3)
0:02.683 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.683 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, static_empowerment(3), elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.524 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, static_empowerment(4), elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.334 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.115 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.868 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.869 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(80)
0:07.624 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.380 st V full_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.880 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.635 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.389 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.142 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.896 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.651 st R sunfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.406 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.159 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.914 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.667 st S moonfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.422 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.422 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.263 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.072 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.851 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.630 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.384 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.138 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.893 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.645 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.400 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.155 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.910 st O warrior_of_elune Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.910 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.663 st T new_moon Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.416 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.170 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.924 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.679 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.433 st W cancel_buff Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.433 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.272 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.084 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.864 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5)
0:33.618 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5)
0:34.372 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5)
0:35.127 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, static_empowerment(5)
0:35.879 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:36.633 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:37.388 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:38.144 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:38.897 st S moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:39.649 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:40.403 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:41.308 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:42.212 st X starsurge Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:43.115 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:44.018 st W cancel_buff Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:44.018 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:45.030 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:45.785 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:46.538 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:47.509 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:48.449 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:49.387 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:50.292 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, static_empowerment(5)
0:51.267 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar(2), undulating_sporecloak, static_empowerment(5)
0:52.341 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, static_empowerment(5)
0:53.414 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, static_empowerment(5)
0:54.486 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, static_empowerment(5)
0:55.559 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:56.555 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:57.549 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:58.544 st W cancel_buff Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:58.544 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(4), undulating_sporecloak, wafting_devotion, static_empowerment(5)
0:59.658 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:00.729 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(5), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:01.801 st P starfire Fluffy_Pillow 17.6/100: 18% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(2), dreamstate, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:02.555 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(2), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:03.400 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:04.338 st S moonfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:05.161 st U half_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, static_empowerment(5)
1:06.257 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, static_empowerment(5)
1:07.079 st R sunfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, static_empowerment(5)
1:07.983 st V full_moon Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, static_empowerment(5)
1:09.789 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, static_empowerment(5)
1:10.694 st O warrior_of_elune Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:10.910 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:11.814 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:12.719 st W cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:12.719 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:13.729 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:14.704 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:15.643 st P starfire Fluffy_Pillow 7.6/100: 8% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:16.398 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
1:17.153 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:18.129 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:19.104 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:20.079 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:21.055 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:22.032 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:23.105 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:24.180 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:25.255 st R sunfire Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:26.328 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:27.404 st W cancel_buff Fluffy_Pillow 75.2/100: 75% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:27.404 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:28.606 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:29.761 default F natures_vigil phial_of_static_empowerment_3 3.2/100: 3% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:30.000 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:31.114 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:32.228 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:32.982 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:33.736 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:34.747 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:35.723 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:36.698 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:37.674 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:38.748 st Y wrath Fluffy_Pillow 2.8/100: 3% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:39.822 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:40.896 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:41.968 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:43.044 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:44.245 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:45.402 default E use_items Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
1:45.402 st R sunfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(100)
1:46.414 st S moonfire Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(95)
1:47.426 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(90)
1:48.437 st T new_moon Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(85)
1:49.193 st U half_moon Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(85)
1:50.492 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(75)
1:51.469 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(70)
1:52.443 st Y wrath Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(65)
1:53.347 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(65)
1:54.251 st X starsurge Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(60)
1:55.155 st P starfire Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(55)
1:56.510 st O warrior_of_elune Fluffy_Pillow 54.8/100: 55% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), starlord(3), dreamstate(2), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(45)
1:56.510 st P starfire Fluffy_Pillow 54.8/100: 55% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(45)
1:57.264 st W cancel_buff Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(45)
1:57.264 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, warrior_of_elune(2), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(45)
1:58.277 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(40)
1:59.251 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(35)
2:00.007 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(30)
2:00.944 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(25)
2:01.881 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(20)
2:02.786 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(15)
2:03.781 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(10)
2:04.775 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(5)
2:05.768 st X starsurge Fluffy_Pillow 71.6/100: 72% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:06.762 st S moonfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:07.755 st X starsurge Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:08.828 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:09.902 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:10.977 st W cancel_buff Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:10.977 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:12.179 st P starfire Fluffy_Pillow 9.6/100: 10% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:12.934 st P starfire Fluffy_Pillow 26.4/100: 26% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:13.689 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:14.664 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:15.601 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:16.504 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:17.408 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:18.313 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:19.307 st R sunfire Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:20.301 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:21.294 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:22.288 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:23.282 st X starsurge Fluffy_Pillow 83.2/100: 83% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:24.276 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:25.269 st W cancel_buff Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:25.269 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:26.383 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
2:27.988 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord, dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:28.934 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:29.985 st S moonfire Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:30.907 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:31.829 st V full_moon Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:33.601 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:34.489 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:35.465 st T new_moon Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:36.218 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:36.972 st R sunfire Fluffy_Pillow 37.2/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:37.944 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:38.921 st W cancel_buff Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:38.921 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:40.014 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
2:41.590 st O warrior_of_elune Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, dreamstate(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:41.590 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:42.344 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune(2), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:43.396 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:44.152 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:45.164 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:46.140 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:47.114 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:48.190 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:49.265 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:50.339 st S moonfire Fluffy_Pillow 52.0/100: 52% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:51.412 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:52.485 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:52.485 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:53.687 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:54.843 st R sunfire Fluffy_Pillow 10.0/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:55.954 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:57.068 st P starfire Fluffy_Pillow 28.0/100: 28% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:57.823 st P starfire Fluffy_Pillow 44.8/100: 45% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:58.577 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
2:59.589 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
3:00.565 default F natures_vigil phial_of_static_empowerment_3 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
3:00.565 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
3:01.542 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5)
3:02.518 st N incarnation_chosen_of_elune Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:02.683 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:03.587 st U half_moon Fluffy_Pillow 7.6/100: 8% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:04.792 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:05.545 st W cancel_buff Fluffy_Pillow 53.6/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:05.545 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:06.559 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:07.533 st V full_moon Fluffy_Pillow 5.6/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:09.404 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:10.343 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:11.246 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:12.150 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:12.904 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:13.807 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:14.710 st S moonfire Fluffy_Pillow 19.6/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:15.615 default E use_items Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
3:15.615 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(100)
3:16.520 st Y wrath Fluffy_Pillow 1.6/100: 2% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, static_empowerment(5), kindled_soul(100)
3:17.425 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(95)
3:18.402 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(90)
3:19.378 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(85)
3:20.352 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(80)
3:21.329 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(75)
3:22.421 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(70)
3:23.472 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(65)
3:24.481 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(60)
3:25.458 st T new_moon Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(55)
3:26.369 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(50)
3:27.344 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(45)
3:28.319 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(40)
3:29.294 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(35)
3:30.270 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(30)
3:31.246 st R sunfire Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(25)
3:32.220 st X starsurge Fluffy_Pillow 91.6/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(20)
3:33.198 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(15)
3:34.173 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(10)
3:35.147 st S moonfire Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(5)
3:36.124 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:37.100 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:38.193 st O warrior_of_elune Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:38.193 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:39.243 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:40.256 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:41.232 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:42.209 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:43.184 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:44.159 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:45.134 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:45.888 st P starfire Fluffy_Pillow 60.4/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:46.642 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:47.618 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:48.506 st U half_moon Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:49.688 st X starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:50.576 st R sunfire Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, static_empowerment(5)
3:51.464 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, static_empowerment(5)
3:52.440 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
3:53.532 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, static_empowerment(5)
3:54.581 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, static_empowerment(5)
3:55.593 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:56.604 st S moonfire Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:57.581 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:58.557 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
3:59.532 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:00.285 st P starfire Fluffy_Pillow 72.0/100: 72% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:01.164 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:02.139 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:03.117 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:04.092 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:05.068 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:06.141 st Y wrath Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:07.216 st W cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:07.216 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:08.418 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:09.574 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:10.687 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:11.800 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:12.912 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:13.986 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:15.059 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:16.665 st P starfire Fluffy_Pillow 60.0/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:17.543 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:18.517 st S moonfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:19.491 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:20.245 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, static_empowerment(5)
4:21.220 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:21.220 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:22.231 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:23.302 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:24.334 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:25.364 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:26.397 st O warrior_of_elune Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:26.397 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:27.393 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:28.388 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:29.382 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:30.377 default F natures_vigil phial_of_static_empowerment_3 72.0/100: 72% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:30.565 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:31.559 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:32.465 st V full_moon Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:34.272 st T new_moon Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:35.026 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:35.026 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, static_empowerment(5)
4:36.040 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5)
4:37.091 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:38.103 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:39.079 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:40.053 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:41.029 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:42.003 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:42.979 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:43.732 st P starfire Fluffy_Pillow 60.8/100: 61% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:44.488 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:45.462 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:46.437 default E use_items Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5)
4:46.437 st J sunfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(100)
4:47.413 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(100)
4:48.389 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, static_empowerment(5), kindled_soul(95)
4:49.364 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(90)
4:49.364 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(90)
4:50.565 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(80)
4:51.721 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(75)
4:52.834 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(70)
4:53.946 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(65)
4:55.057 st U half_moon Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(60)
4:56.488 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(50)
4:57.565 st P starfire Fluffy_Pillow 60.0/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(45)
4:59.173 st P starfire Fluffy_Pillow 72.0/100: 72% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(40)
5:00.052 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(35)
5:01.026 st R sunfire Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, static_empowerment(5), kindled_soul(30)
5:02.001 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(25)
5:02.976 default D potion Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), kindled_soul(20)
5:02.976 st S moonfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(20)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15976 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15976 14916 0
Crit 22.51% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16615 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_static_empowerment_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_tepid_versatility_3 : 246696 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
246696.1 246696.1 123.1 / 0.050% 36161.3 / 14.7% 19411.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_tepid_versatility_3 246696
Astral Smolder 16664 6.8% 60.5 4.93s 82731 0 Periodic 113.1 44224 0 44224 0.0% 75.4%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.47 0.00 113.12 113.12 44.29 0.0000 2.0000 5002668.42 5002668.42 0.00% 22112.02 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 113.12 65 155 44223.99 9789 165155 44230.14 32457 58662 5002668 5002668 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7938) 0.0% (3.2%) 8.7 31.32s 274894 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13540 3.2% 154.3 1.68s 15459 12104 Direct 153.4 12554 25059 15556 24.0%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.32 153.36 0.00 0.00 0.00 1.2772 0.0000 2385652.61 2385652.61 0.00% 12103.52 12103.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.00% 116.55 25 310 12553.77 8220 21714 12544.16 11128 14693 1463127 1463127 0.00%
crit 24.00% 36.81 4 107 25059.44 16918 43429 25046.77 22032 30853 922526 922526 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.100
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:17818.78
Hungering Shadowflame 4040 1.6% 17.5 16.53s 69454 0 Direct 17.5 56016 111937 69449 24.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.49 17.49 0.00 0.00 0.00 0.0000 0.0000 1215058.10 1215058.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.98% 13.29 3 31 56015.51 37064 216734 55792.79 37420 124051 744528 744528 0.00%
crit 24.02% 4.20 0 15 111936.76 74128 433468 110196.07 0 433468 470530 470530 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3766 1.5% 35.3 8.47s 32095 0 Direct 35.2 25965 51877 32180 24.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.26 35.17 0.00 0.00 0.00 0.0000 0.0000 1131710.14 1131710.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.01% 26.73 11 48 25965.06 25199 29470 25964.32 25514 26953 694054 694054 0.00%
crit 23.99% 8.44 0 22 51876.70 50397 58941 51868.38 0 58941 437656 437656 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13246 5.4% 14.4 21.60s 276532 287501 Direct 14.4 9901 20348 13153 31.1%
Periodic 314.3 8952 18745 12050 31.6% 99.7%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.38 14.38 314.28 314.28 13.38 0.9618 0.9520 3976143.72 3976143.72 0.00% 12702.20 287501.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.88% 9.90 2 17 9900.69 6542 18861 9905.09 8243 12407 98055 98055 0.00%
crit 31.12% 4.47 0 12 20348.48 13001 37721 20257.40 0 32259 91050 91050 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.37% 214.88 145 287 8952.44 190 16409 8956.84 8419 9727 1923700 1923700 0.00%
crit 31.63% 99.40 59 148 18745.15 4592 32817 18757.40 17269 20611 1863338 1863338 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.12
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23518) 0.0% (9.5%) 17.0 17.94s 414475 351030

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.05 0.00 0.00 0.00 0.00 1.1808 0.0000 0.00 0.00 0.00% 351030.42 351030.42

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8629 3.5% 5.3 62.55s 488641 267112 Direct 5.3 348354 681225 491552 43.0%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 5.29 0.00 0.00 0.00 1.8294 0.0000 2599803.75 2599803.75 0.00% 267112.27 267112.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.99% 3.01 0 6 348353.57 197810 589793 344254.33 0 558702 1049974 1049974 0.00%
crit 43.01% 2.28 0 6 681225.35 400415 1179586 643741.03 0 1117404 1549830 1549830 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.37
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6374 2.6% 6.0 53.43s 316827 419920 Direct 6.0 213425 447198 318565 45.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 5.99 0.00 0.00 0.00 0.7545 0.0000 1908958.55 1908958.55 0.00% 419920.49 419920.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.02% 3.30 0 7 213425.49 103382 336463 211479.36 0 324852 703595 703595 0.00%
crit 44.98% 2.70 0 7 447198.25 229345 669453 438042.47 0 658094 1205364 1205364 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.04
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8516 3.5% 5.7 57.82s 448454 369795 Direct 5.7 301962 600445 450910 49.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.67 0.00 0.00 0.00 1.2129 0.0000 2557129.03 2557129.03 0.00% 369794.51 369794.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.10% 2.84 0 7 301961.93 163473 479816 295522.20 0 461205 858022 858022 0.00%
crit 49.90% 2.83 0 7 600444.70 329684 962486 586422.87 0 940033 1699107 1699107 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.73
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21952) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8193 3.3% 96.2 3.11s 25589 0 Direct 95.9 17766 37311 25658 40.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.18 95.92 0.00 0.00 0.00 0.0000 0.0000 2461106.62 2461106.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.62% 57.19 27 97 17766.33 10467 35604 17773.05 15428 20546 1016049 1016049 0.00%
crit 40.38% 38.73 17 68 37310.89 20934 71208 37332.48 32677 45411 1445058 1445058 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8204 3.3% 96.5 3.09s 25532 0 Direct 96.3 17738 37262 25602 40.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.51 96.25 0.00 0.00 0.00 0.0000 0.0000 2464214.04 2464214.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.73% 57.49 24 94 17737.63 10467 35604 17743.94 15608 20228 1019700 1019700 0.00%
crit 40.27% 38.77 14 66 37262.04 20934 71208 37278.46 31929 43160 1444514 1444514 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5555 2.3% 6.4 47.28s 259605 0 Direct 6.4 179726 377776 260455 40.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.43 6.41 0.00 0.00 0.00 0.0000 0.0000 1668640.47 1668640.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.24% 3.80 0 8 179726.45 105693 349365 178976.33 0 329569 682069 682069 0.00%
crit 40.76% 2.61 0 9 377776.44 214001 707752 364124.57 0 685173 986572 986572 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6014 2.4% 26.1 11.51s 69541 77170 Direct 27.1 48934 97754 66969 36.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.05 27.05 0.00 0.00 0.00 0.9012 0.0000 1811559.99 1811559.99 0.00% 77169.75 77169.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.06% 17.06 5 30 48934.09 21620 100288 48926.20 39875 56897 834699 834699 0.00%
crit 36.94% 9.99 0 22 97754.25 43240 191586 97737.55 0 123997 976861 976861 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.10
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80146 (108271) 32.5% (43.9%) 117.0 2.56s 277606 284128 Direct 116.8 (155.3) 145749 302335 205936 38.4% (39.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.01 116.77 0.00 0.00 0.00 0.9771 0.0000 24046078.34 24046078.34 0.00% 284127.54 284127.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.56% 71.89 44 104 145749.16 90041 283025 145827.13 133963 161403 10477211 10477211 0.00%
crit 38.44% 44.88 22 71 302334.83 191375 566050 302558.12 268071 347767 13568867 13568867 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.57
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.45
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28125 11.4% 38.7 7.67s 218182 0 Direct 38.5 153345 315655 219225 40.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.67 38.49 0.00 0.00 0.00 0.0000 0.0000 8437938.69 8437938.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.41% 22.87 5 46 153344.58 99072 295947 153430.12 128970 186524 3506525 3506525 0.00%
crit 40.59% 15.62 3 32 315654.76 200112 591893 315879.88 247853 397736 4931414 4931414 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13276 5.4% 17.4 18.05s 228809 238223 Direct 17.4 9901 20074 13420 34.6%
Periodic 315.2 8827 17912 11908 33.9% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.43 17.43 315.24 315.24 16.43 0.9605 0.9520 3987848.22 3987848.22 0.00% 12585.28 238222.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.41% 11.40 3 20 9901.11 5876 17146 9890.79 8326 11819 112867 112867 0.00%
crit 34.59% 6.03 0 14 20074.21 11752 34292 20051.18 0 32397 121033 121033 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.08% 208.32 138 275 8826.80 340 15384 8826.19 8266 9396 1838805 1838805 0.00%
crit 33.92% 106.92 64 160 17911.90 663 30768 17913.49 16461 19122 1915143 1915143 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.43
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:16.00
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4286) 0.0% (1.7%) 8.7 31.08s 148664 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2233 0.9% 8.7 31.08s 77454 0 Direct 8.7 62447 124761 77449 24.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.66 8.66 0.00 0.00 0.00 0.0000 0.0000 670819.25 670819.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.92% 6.58 0 18 62446.65 60550 70814 62408.41 0 70814 410592 410592 0.00%
crit 24.08% 2.09 0 10 124761.23 121100 141629 110448.77 0 141629 260227 260227 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2053 0.8% 16.8 15.20s 36812 0 Direct 16.8 29695 59342 36812 24.0%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.75 16.75 0.00 0.00 0.00 0.0000 0.0000 616741.53 616741.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.99% 12.73 1 34 29695.20 28811 33696 29694.75 28962 32580 378079 378079 0.00%
crit 24.01% 4.02 0 15 59342.47 57623 67391 58032.13 0 67391 238662 238662 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23727 9.6% 118.2 2.49s 60279 64277 Direct 117.7 41530 85780 60505 42.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.16 117.73 0.00 0.00 0.00 0.9378 0.0000 7122866.89 7122866.89 0.00% 64277.10 64277.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.12% 67.25 39 101 41530.30 15960 128359 41538.58 36496 46614 2792740 2792740 0.00%
crit 42.88% 50.48 25 80 85779.83 31920 259462 85800.62 72737 100607 4330127 4330127 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.48

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_tepid_versatility_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Tepid Versatility 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 192.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 306.31s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.24s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.08
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.12% 29.10% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:2.7s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.01% / 27.78%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.94%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.30%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.5 3.0 16.6s 14.2s 8.3s 50.79% 54.75% 3.0 (17.8) 17.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.1s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:45.86% / 54.94%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.03%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.37%
  • balance_of_all_things_nature_6:6.52%
  • balance_of_all_things_nature_7:6.67%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.0 44.2s 4.1s 20.2s 48.56% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:0.8s / 41.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.78% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.36%
  • balance_t31_4pc_buff_lunar_3:4.87%
  • balance_t31_4pc_buff_lunar_4:5.61%
  • balance_t31_4pc_buff_lunar_5:29.10%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.1 102.9 22.0s 2.6s 19.3s 90.56% 0.00% 49.1 (49.1) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.35% / 93.32%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.52%
  • balance_t31_4pc_buff_solar_2:11.48%
  • balance_t31_4pc_buff_solar_3:15.97%
  • balance_t31_4pc_buff_solar_4:11.69%
  • balance_t31_4pc_buff_solar_5:43.90%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 344.3s
  • trigger_min/max:12.0s / 344.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.65%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.0s 70.1s 45.9s 33.49% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.9s
  • trigger_min/max:12.0s / 344.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 335.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.49%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.5s 70.5s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.9s
  • trigger_min/max:12.0s / 336.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.70%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.2s 70.5s 45.6s 33.20% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 340.2s
  • trigger_min/max:12.0s / 336.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 348.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.20%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.6s 70.6s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 342.8s
  • trigger_min/max:12.0s / 342.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.43%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.7s 70.6s 45.7s 33.31% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 348.9s
  • trigger_min/max:12.0s / 342.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.31%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Denizen of the Dream 8.7 0.0 45.0s 31.6s 41.5s 57.97% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.0s
  • trigger_min/max:0.0s / 143.7s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 241.6s
  • uptime_min/max:20.21% / 96.97%

Stack Uptimes

  • denizen_of_the_dream_1:38.88%
  • denizen_of_the_dream_2:14.69%
  • denizen_of_the_dream_3:3.63%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.3 0.7 20.3s 20.6s 3.0s 15.29% 20.62% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.7s
  • uptime_min/max:8.76% / 25.81%

Stack Uptimes

  • dreamstate_1:9.48%
  • dreamstate_2:5.81%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.2s 20.6s 49.56% 52.69% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.15% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.56%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.8s 20.1s 93.09% 96.26% 5.5 (5.5) 13.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.2s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.70% / 95.26%

Stack Uptimes

  • eclipse_solar_1:93.09%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.27% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.1s 31.6s 25.0s 44.03% 43.97% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 190.7s
  • trigger_min/max:0.0s / 143.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.3s
  • uptime_min/max:14.15% / 85.68%

Stack Uptimes

  • friend_of_the_fae_1:44.03%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.3s 48.66% 51.43% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.8s
  • trigger_min/max:12.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.41% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.66%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.36% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 123.9s
  • trigger_min/max:90.0s / 123.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.30% / 26.30%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 13.0 0.0 20.5s 20.5s 5.9s 25.51% 0.00% 0.0 (0.0) 12.7

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.7s
  • trigger_min/max:12.8s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:20.00% / 30.72%

Stack Uptimes

  • natures_grace_1:25.51%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.4s 68.3s 7.7s 6.34% 7.03% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 340.8s
  • trigger_min/max:0.0s / 340.8s
  • trigger_pct:14.91%
  • duration_min/max:0.0s / 30.1s
  • uptime_min/max:0.00% / 33.48%

Stack Uptimes

  • owlkin_frenzy_1:6.34%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.7 38.4s 38.4s 34.4s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.3s / 49.9s
  • trigger_min/max:24.3s / 49.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s
  • uptime_min/max:90.53% / 96.78%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.24%
  • primordial_arcanic_pulsar_12:6.72%
  • primordial_arcanic_pulsar_16:6.81%
  • primordial_arcanic_pulsar_20:6.56%
  • primordial_arcanic_pulsar_24:6.05%
  • primordial_arcanic_pulsar_28:6.93%
  • primordial_arcanic_pulsar_32:8.29%
  • primordial_arcanic_pulsar_36:6.62%
  • primordial_arcanic_pulsar_40:7.20%
  • primordial_arcanic_pulsar_44:7.33%
  • primordial_arcanic_pulsar_48:6.86%
  • primordial_arcanic_pulsar_52:7.70%
  • primordial_arcanic_pulsar_56:6.76%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.8 3.7 16.5s 14.2s 6.4s 39.71% 39.92% 3.7 (3.7) 18.3

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.5s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s
  • uptime_min/max:36.19% / 42.62%

Stack Uptimes

  • solstice_1:39.71%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.2 14.7s 2.6s 14.1s 97.33% 0.00% 54.9 (54.9) 7.7

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.46% / 99.14%

Stack Uptimes

  • starlord_1:9.22%
  • starlord_2:14.75%
  • starlord_3:73.36%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.2 48.5 48.2s 5.5s 43.5s 90.23% 0.00% 54.6 (54.6) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 335.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.5s
  • uptime_min/max:73.20% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.23%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.1s 45.5s 16.5s 23.66% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 229.9s
  • trigger_min/max:0.0s / 216.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 85.2s
  • uptime_min/max:4.66% / 63.40%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.79% 42.91% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.1s
  • trigger_min/max:45.0s / 82.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:31.89% / 51.24%

Stack Uptimes

  • warrior_of_elune_1:20.35%
  • warrior_of_elune_2:5.32%
  • warrior_of_elune_3:18.12%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 23.0 31.6s 0.0s 143.7s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 29.3s 50.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.75% 0.5s 0.0s 3.3s
Astral Smolder 75.47% 53.04% 92.81% 14.0s 0.0s 118.0s
Incarnation (Total) 48.66% 43.41% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.45% 26.14% 30.84% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.90% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.43% 35.95% 50.52% 11.0s 0.0s 15.0s
No Eclipse 5.99% 3.59% 8.45% 1.4s 0.0s 3.5s
Friend of the Fae 44.03% 14.15% 85.68% 25.0s 0.0s 145.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8250.00037.79147.68026.11673.276
Full Moon
New Moon
Half Moon
0.3410.00025.4205.8145.28231.034

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.114.4%58.0550.0%0.000.0%53.0145.6%
Starfire25.0492.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.8440.0%0.000.0%70.1860.0%
New Moon0.020.4%0.274.5%0.000.0%5.7395.2%
Half Moon0.000.0%0.335.8%0.000.0%5.3794.2%
Full Moon0.201.7%3.1226.5%0.080.7%8.3571.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_tepid_versatility_3
Nature's BalanceAstral Power99.71199.325.41%2.000.100.05%
Full MoonAstral Power5.32265.637.21%49.930.370.14%
Half MoonAstral Power5.70136.863.71%24.000.000.00%
MoonfireAstral Power14.3886.202.34%5.990.070.08%
New MoonAstral Power6.0372.301.96%12.000.000.00%
Orbit BreakerAstral Power6.43191.775.20%29.831.060.55%
Shooting Stars (Moonfire)Astral Power96.18192.165.21%2.000.200.11%
Shooting Stars (Sunfire)Astral Power96.51192.825.23%2.000.200.10%
StarfireAstral Power27.05396.3510.75%14.652.970.74%
SunfireAstral Power17.43104.562.84%6.000.010.01%
WrathAstral Power118.161847.9550.14%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_tepid_versatility_3
StarsurgeAstral Power 117.193698.10100.00%31.5631.608783.98
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 1974.39 2268.19 2357613.7 807714.7 423984.2 896040.0
Astral Power 70.0 12.26 12.28 5.0 23.4 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_tepid_versatility_3 Fight Length
Count 21349
Mean 300.63
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.96%
Standard Deviation 34.7243
5th Percentile 246.20
95th Percentile 354.07
( 95th Percentile - 5th Percentile ) 107.87
Mean Distribution
Standard Deviation 0.2377
95.00% Confidence Interval ( 300.17 - 301.10 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51250
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1030
DPS
phial_of_tepid_versatility_3 Damage Per Second
Count 21349
Mean 246696.09
Minimum 215665.34
Maximum 290335.93
Spread ( max - min ) 74670.59
Range [ ( max - min ) / 2 * 100% ] 15.13%
Standard Deviation 9180.6393
5th Percentile 232200.66
95th Percentile 262456.82
( 95th Percentile - 5th Percentile ) 30256.16
Mean Distribution
Standard Deviation 62.8325
95.00% Confidence Interval ( 246572.94 - 246819.24 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5321
0.1 Scale Factor Error with Delta=300 719498
0.05 Scale Factor Error with Delta=300 2877992
0.01 Scale Factor Error with Delta=300 71949789
Priority Target DPS
phial_of_tepid_versatility_3 Priority Target Damage Per Second
Count 21349
Mean 246696.09
Minimum 215665.34
Maximum 290335.93
Spread ( max - min ) 74670.59
Range [ ( max - min ) / 2 * 100% ] 15.13%
Standard Deviation 9180.6393
5th Percentile 232200.66
95th Percentile 262456.82
( 95th Percentile - 5th Percentile ) 30256.16
Mean Distribution
Standard Deviation 62.8325
95.00% Confidence Interval ( 246572.94 - 246819.24 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5321
0.1 Scale Factor Error with Delta=300 719498
0.05 Scale Factor Error with Delta=300 2877992
0.01 Scale Factor Error with Delta=300 71949789
DPS(e)
phial_of_tepid_versatility_3 Damage Per Second (Effective)
Count 21349
Mean 246696.09
Minimum 215665.34
Maximum 290335.93
Spread ( max - min ) 74670.59
Range [ ( max - min ) / 2 * 100% ] 15.13%
Damage
phial_of_tepid_versatility_3 Damage
Count 21349
Mean 71679285.73
Minimum 53765781.16
Maximum 92123512.82
Spread ( max - min ) 38357731.66
Range [ ( max - min ) / 2 * 100% ] 26.76%
DTPS
phial_of_tepid_versatility_3 Damage Taken Per Second
Count 21349
Mean 2269.13
Minimum 826.12
Maximum 4507.11
Spread ( max - min ) 3680.99
Range [ ( max - min ) / 2 * 100% ] 81.11%
HPS
phial_of_tepid_versatility_3 Healing Per Second
Count 21349
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_tepid_versatility_3 Healing Per Second (Effective)
Count 21349
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_tepid_versatility_3 Heal
Count 21349
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_tepid_versatility_3 Healing Taken Per Second
Count 21349
Mean 1971.41
Minimum 582.01
Maximum 4168.21
Spread ( max - min ) 3586.20
Range [ ( max - min ) / 2 * 100% ] 90.96%
TMI
phial_of_tepid_versatility_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_tepid_versatility_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_tepid_versatility_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.43 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.08 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.10 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.57 starsurge,if=variable.starsurge_condition1
R 16.00 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.12 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.04 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.73 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.37 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.45 starsurge,if=variable.starsurge_condition2
Y 116.48 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVQYXYRXYYXSYQQQYYYYXYYXOTYXQYYRWQQYQYYYYXSYXYXYXPPYQQRYQYYYYXYPPWQQQSQUQRVOYXXYWQPPQYQYYQSRYYYWQFQYPPQYQYYQYYRYQSYQETQUQYQYYOYWQQQPPQRYQYSYYYWQQYYQPPQRYQYYYYQQSVQQQTYXRYPPWQQYQYYQYOYYSYXWQRPPQYQFYQYYYYYWQQUQRQSVYXEXPNYYQQQTYQQRYYYSXYYWQQQYYYYXOUYXQRYYWQQQYSYYYXYXYXPPRQQYYQYYYYXSPPWQQYRQYYYYFOXQYYWQQQVSTXRPPQYXYYEQQYQYYYPPQRDSUWQQV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 1 food phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 2 augmentation phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 4 no_cd_talent phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 5 on_use_trinket phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 6 on_use_trinket phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 7 on_use_trinket phial_of_tepid_versatility_3 50.0/100: 50% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil phial_of_tepid_versatility_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:00.926 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak
0:01.852 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak
0:02.686 st N incarnation_chosen_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak
0:02.686 default D potion Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak
0:02.686 default E use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power
0:02.686 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.528 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.283 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.036 st T new_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.789 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.543 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.470 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.224 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.613 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.370 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.123 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.876 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.632 st R sunfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.386 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.141 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.896 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.651 st X starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.407 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.162 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.918 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.698 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.509 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.288 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.042 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.795 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.551 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.306 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak, elemental_potion_of_ultimate_power
0:24.062 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, undulating_sporecloak, elemental_potion_of_ultimate_power
0:24.818 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, elemental_potion_of_ultimate_power
0:25.571 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.324 st O warrior_of_elune Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.324 st T new_moon Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.079 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.835 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), undulating_sporecloak, elemental_potion_of_ultimate_power
0:28.591 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.344 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, elemental_potion_of_ultimate_power
0:30.098 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), undulating_sporecloak, elemental_potion_of_ultimate_power
0:30.853 st R sunfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.607 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.607 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.448 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, elemental_potion_of_ultimate_power
0:33.257 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), undulating_sporecloak
0:34.038 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), undulating_sporecloak
0:34.818 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak
0:35.572 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, undulating_sporecloak
0:36.328 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, undulating_sporecloak
0:37.081 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:37.836 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:38.591 st S moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:39.345 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:40.098 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:41.074 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:42.049 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:43.024 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:43.999 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
0:44.976 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak
0:45.730 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), undulating_sporecloak
0:46.486 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, undulating_sporecloak
0:47.461 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, undulating_sporecloak
0:48.553 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak
0:49.604 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak
0:50.616 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2)
0:51.628 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2)
0:52.741 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3)
0:53.816 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3)
0:54.889 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3)
0:55.960 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3)
0:57.034 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3)
0:58.108 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4)
0:59.182 st P starfire Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4)
1:00.789 st P starfire Fluffy_Pillow 83.6/100: 84% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate
1:01.666 st W cancel_buff Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate
1:01.666 st Q starsurge Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate
1:02.757 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate
1:03.809 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate
1:04.820 st S moonfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, dreamstate
1:05.708 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, dreamstate
1:06.596 st U half_moon Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), dreamstate
1:07.780 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), dreamstate
1:08.755 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), dreamstate
1:09.731 st V full_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), dreamstate
1:11.676 st O warrior_of_elune Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), dreamstate, undulating_sporecloak
1:11.676 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), undulating_sporecloak
1:12.431 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), undulating_sporecloak
1:13.405 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), undulating_sporecloak
1:14.382 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
1:15.358 st W cancel_buff Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
1:15.358 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak
1:16.450 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), dreamstate, undulating_sporecloak
1:17.206 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(2), undulating_sporecloak
1:17.960 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, undulating_sporecloak
1:19.011 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak
1:20.024 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak
1:21.035 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:22.010 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:23.084 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:24.157 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:25.232 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:26.304 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:27.377 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:28.451 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:29.523 st W cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:29.523 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:30.725 default F natures_vigil phial_of_tepid_versatility_3 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), undulating_sporecloak
1:30.725 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), undulating_sporecloak
1:31.880 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), undulating_sporecloak
1:32.994 st P starfire Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, undulating_sporecloak
1:33.747 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(2), undulating_sporecloak
1:34.656 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), undulating_sporecloak
1:35.669 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, undulating_sporecloak
1:36.645 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, undulating_sporecloak
1:37.621 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:38.597 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:39.670 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), undulating_sporecloak
1:40.743 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:41.816 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:42.890 st R sunfire Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak
1:43.963 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
1:45.035 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
1:46.238 st S moonfire Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
1:47.393 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
1:48.548 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
1:49.703 default E use_items Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
1:49.703 st T new_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:50.460 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:51.472 st U half_moon Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(95)
1:52.770 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(85)
1:53.674 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(85)
1:54.578 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(80)
1:55.483 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(75)
1:56.387 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(70)
1:57.292 st O warrior_of_elune Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(65)
1:57.292 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(65)
1:58.197 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(60)
1:58.197 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(60)
1:59.208 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(55)
2:00.182 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(50)
2:01.118 st P starfire Fluffy_Pillow 10.0/100: 10% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(45)
2:01.872 st P starfire Fluffy_Pillow 26.8/100: 27% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(40)
2:02.627 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(40)
2:03.531 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(35)
2:04.435 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(30)
2:05.338 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(25)
2:06.242 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(20)
2:07.146 st S moonfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(15)
2:08.220 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(10)
2:09.293 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(5)
2:10.367 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
2:11.441 st W cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
2:11.441 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
2:12.643 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
2:13.798 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:14.910 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:16.022 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:17.135 st P starfire Fluffy_Pillow 11.6/100: 12% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:17.889 st P starfire Fluffy_Pillow 30.4/100: 30% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:18.643 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:19.616 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:20.592 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:21.567 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:22.543 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
2:23.518 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:24.513 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:25.507 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:26.501 st Q starsurge Fluffy_Pillow 87.2/100: 87% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:27.614 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:28.685 st S moonfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:29.623 st V full_moon Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:31.494 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:32.432 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:33.336 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:34.240 st T new_moon Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:34.995 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:35.898 st X starsurge Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:36.803 st R sunfire Fluffy_Pillow 13.2/100: 13% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:37.706 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:38.612 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
2:40.072 st P starfire Fluffy_Pillow 49.2/100: 49% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
2:40.953 st W cancel_buff Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
2:40.953 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
2:42.045 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
2:43.095 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
2:43.851 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
2:44.863 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
2:45.838 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
2:46.913 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak
2:47.987 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak
2:49.061 st O warrior_of_elune Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
2:49.061 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
2:50.134 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:51.208 st S moonfire Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:52.281 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:53.356 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
2:54.430 st W cancel_buff Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
2:54.430 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
2:55.631 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
2:56.785 st P starfire Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord, warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:57.541 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
2:58.295 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak
2:59.346 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
3:00.358 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
3:01.369 default F natures_vigil phial_of_tepid_versatility_3 18.8/100: 19% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
3:01.369 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
3:02.344 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
3:03.418 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
3:04.491 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
3:05.565 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
3:06.639 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
3:07.712 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
3:08.786 st W cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
3:08.786 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
3:09.989 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
3:11.146 st U half_moon Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
3:12.495 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
3:13.507 st R sunfire Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
3:14.482 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
3:15.458 st S moonfire Fluffy_Pillow 8.8/100: 9% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak
3:16.432 st V full_moon Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak
3:18.379 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak
3:19.354 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak
3:20.329 default E use_items Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak
3:20.329 st X starsurge Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
3:21.305 st P starfire Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
3:22.765 st N incarnation_chosen_of_elune Fluffy_Pillow 44.8/100: 45% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(90)
3:22.765 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(90)
3:23.520 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(85)
3:24.275 st Q starsurge Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(85)
3:25.269 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
3:26.225 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(75)
3:27.144 st T new_moon Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(70)
3:27.898 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
3:28.786 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(60)
3:29.762 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
3:30.736 st R sunfire Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(50)
3:31.711 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(45)
3:32.686 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(40)
3:33.661 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(35)
3:34.637 st S moonfire Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(30)
3:35.612 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(25)
3:36.588 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(20)
3:37.563 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(15)
3:38.538 st W cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(10)
3:38.538 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(10)
3:39.631 st Q starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(5)
3:40.681 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:41.692 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
3:42.668 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:43.572 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:44.477 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:45.382 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:46.287 st O warrior_of_elune Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:46.287 st U half_moon Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:47.493 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:48.398 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:49.301 st Q starsurge Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:50.204 st R sunfire Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:51.108 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:52.012 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:52.916 st W cancel_buff Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:52.916 st Q starsurge Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:53.930 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:54.904 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:55.842 st Y wrath Fluffy_Pillow 2.8/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:56.745 st S moonfire Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
3:57.650 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:58.627 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
3:59.603 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:00.578 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:01.555 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:02.529 st X starsurge Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:03.505 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:04.482 st X starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
4:05.455 st P starfire Fluffy_Pillow 34.8/100: 35% astral_power natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
4:06.209 st P starfire Fluffy_Pillow 53.6/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak
4:06.961 st R sunfire Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
4:07.937 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
4:09.029 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:10.077 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
4:11.087 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
4:12.199 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
4:13.310 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
4:14.382 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
4:15.455 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
4:16.528 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
4:17.600 st X starsurge Fluffy_Pillow 82.4/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
4:18.672 st S moonfire Fluffy_Pillow 48.4/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
4:19.745 st P starfire Fluffy_Pillow 56.4/100: 56% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:21.352 st P starfire Fluffy_Pillow 70.4/100: 70% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
4:22.229 st W cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
4:22.229 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
4:23.322 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static
4:24.373 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
4:25.128 st R sunfire Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:26.140 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:27.152 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:28.127 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:29.201 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:30.274 st Y wrath Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:31.348 default F natures_vigil phial_of_tepid_versatility_3 78.4/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:31.369 st O warrior_of_elune Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:31.369 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:32.443 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak
4:33.419 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:34.394 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:35.370 st W cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:35.370 st Q starsurge Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:36.462 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:37.513 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
4:38.523 st V full_moon Fluffy_Pillow 10.4/100: 10% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
4:40.469 st S moonfire Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
4:41.443 st T new_moon Fluffy_Pillow 74.4/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
4:42.198 st X starsurge Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
4:43.174 st R sunfire Fluffy_Pillow 62.4/100: 62% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
4:44.148 st P starfire Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:44.904 st P starfire Fluffy_Pillow 85.2/100: 85% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:45.659 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:46.637 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:47.611 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
4:48.586 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:49.561 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
4:50.634 default E use_items Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
4:50.634 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, kindled_soul(100)
4:51.834 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, kindled_soul(95)
4:52.991 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, kindled_soul(90)
4:54.104 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, kindled_soul(85)
4:55.217 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, kindled_soul(80)
4:56.290 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, kindled_soul(75)
4:57.364 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, kindled_soul(70)
4:58.439 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, kindled_soul(65)
5:00.049 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(55)
5:00.928 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(50)
5:01.904 st R sunfire Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(45)
5:02.882 default D potion Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(40)
5:02.882 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(40)
5:03.857 st U half_moon Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(35)
5:05.156 st W cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(30)
5:05.156 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(30)
5:06.248 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(25)
5:07.405 st V full_moon Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, elemental_potion_of_ultimate_power, kindled_soul(20)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 853380 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 22.51% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 12.78% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 29.33% 29.33% 7622
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_tepid_versatility_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 21381
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.2 )

Performance:

Total Events Processed: 794184486
Max Event Queue: 77
Sim Seconds: 6417579
CPU Seconds: 725.5152
Physical Seconds: 30.5522
Speed Up: 8846

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Base Base astral_smolder ticks -394061 4828494 16095 22.56 42804 0 60.3 112.8 0.0% 0.0% 0.0% 0.0% 4.93sec 4828494 299.65sec
Base Base augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
Base Base denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.52sec 0 299.65sec
Base Base fey_missile 188046 2309763 7708 30.69 12159 24279 154.2 153.3 24.0% 0.0% 0.0% 0.0% 1.69sec 2309763 299.65sec
Base Base food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
Base Base hungering_shadowflame 424324 1171789 3910 3.49 54186 107929 17.4 17.4 24.2% 0.0% 0.0% 0.0% 16.53sec 1171789 299.65sec
Base Base hungering_shadowflame_self 424324 671393 2241 3.49 31030 62038 17.4 17.4 24.1% 0.0% 0.0% 0.0% 16.53sec 762728 299.65sec
Base Base incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.52sec 0 299.65sec
Base Base launched_thorns 379403 1091710 3643 7.01 25149 50256 35.1 35.0 23.9% 0.0% 0.0% 0.0% 8.33sec 1091710 299.65sec
Base Base moonfire 8921 182658 610 2.87 9592 19733 14.3 14.3 31.0% 0.0% 0.0% 0.0% 21.60sec 3840381 299.65sec
Base Base moonfire ticks -8921 3657723 12192 62.66 8674 18163 14.3 313.3 31.6% 0.0% 0.0% 0.0% 21.60sec 3840381 299.65sec
Base Base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
Base Base moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 299.65sec
Base Base full_moon 274283 2505094 8360 1.06 336954 660664 5.3 5.3 42.7% 0.0% 0.0% 0.0% 62.60sec 2505094 299.65sec
Base Base new_moon 274281 1845275 6158 1.20 206887 433194 6.0 6.0 45.1% 0.0% 0.0% 0.0% 53.50sec 1845275 299.65sec
Base Base half_moon 274282 2469144 8240 1.13 292724 581134 5.7 5.7 49.9% 0.0% 0.0% 0.0% 57.78sec 2469144 299.65sec
Base Base natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 299.65sec
Base Base potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.36sec 0 299.65sec
Base Base shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
Base Base shooting_stars_moonfire 202497 2379997 7943 19.17 17213 36161 96.0 95.7 40.4% 0.0% 0.0% 0.0% 3.10sec 2379997 299.65sec
Base Base shooting_stars_sunfire 202497 2384619 7958 19.23 17189 36112 96.3 96.0 40.4% 0.0% 0.0% 0.0% 3.09sec 2384619 299.65sec
Base Base orbit_breaker 274283 1616528 5395 1.28 174332 366397 6.4 6.4 40.9% 0.0% 0.0% 0.0% 47.23sec 1616528 299.65sec
Base Base starfire 194153 1746365 5828 5.39 47394 94596 25.9 26.9 36.9% 0.0% 0.0% 0.0% 11.49sec 1746365 299.65sec
Base Base starsurge 78674 23233956 77536 23.31 141239 292965 116.7 116.4 38.4% 0.0% 0.0% 0.0% 2.55sec 23233956 299.65sec
Base Base goldrinns_fang 394047 8138989 27161 7.67 148531 306057 38.5 38.3 40.6% 0.0% 0.0% 0.0% 7.69sec 8138989 299.65sec
Base Base sunfire 93402 225893 754 3.48 9590 19465 17.4 17.4 34.5% 0.0% 0.0% 0.0% 18.04sec 3852559 299.65sec
Base Base sunfire ticks -93402 3626665 12089 62.86 8551 17352 17.4 314.3 34.0% 0.0% 0.0% 0.0% 18.04sec 3852559 299.65sec
Base Base tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.94sec 0 299.65sec
Base Base denizen_of_the_flame 426486 646812 2159 1.73 60485 120851 8.6 8.6 24.1% 0.0% 0.0% 0.0% 31.94sec 646812 299.65sec
Base Base denizen_of_the_flame_secondary 426431 594647 1984 3.34 28764 57473 16.7 16.7 23.9% 0.0% 0.0% 0.0% 15.55sec 594647 299.65sec
Base Base warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.19sec 0 299.65sec
Base Base wrath 190984 6878170 22954 23.50 40233 83095 117.8 117.4 42.9% 0.0% 0.0% 0.0% 2.49sec 6878170 299.65sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 astral_smolder ticks -394061 5029618 16765 22.60 44512 0 60.4 113.0 0.0% 0.0% 0.0% 0.0% 4.90sec 5029618 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.50sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 fey_missile 188046 2390619 7964 30.53 12637 25223 153.7 152.7 24.0% 0.0% 0.0% 0.0% 1.70sec 2390619 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 flask 371386 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 hungering_shadowflame 424324 1175785 3917 3.49 54244 108478 17.5 17.5 24.1% 0.0% 0.0% 0.0% 16.61sec 1175785 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 hungering_shadowflame_self 424324 672633 2241 3.49 31033 62041 17.5 17.5 24.1% 0.0% 0.0% 0.0% 16.61sec 764231 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.73sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 launched_thorns 379403 1091800 3637 7.00 25155 50269 35.1 35.0 24.0% 0.0% 0.0% 0.0% 8.37sec 1091800 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonfire 8921 190189 634 2.87 9974 20494 14.4 14.4 31.1% 0.0% 0.0% 0.0% 21.60sec 3994432 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonfire ticks -8921 3804242 12681 62.77 9010 18853 14.4 313.8 31.6% 0.0% 0.0% 0.0% 21.60sec 3994432 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.95sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 full_moon 274283 2601723 8668 1.06 349416 685648 5.3 5.3 42.5% 0.0% 0.0% 0.0% 62.52sec 2601723 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 new_moon 274281 1910734 6366 1.20 214064 447421 6.0 6.0 45.0% 0.0% 0.0% 0.0% 53.53sec 1910734 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 half_moon 274282 2561107 8532 1.13 302671 601629 5.7 5.7 50.0% 0.0% 0.0% 0.0% 57.76sec 2561107 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.34sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.44sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars_moonfire 202497 2471294 8233 19.15 17879 37533 96.1 95.8 40.3% 0.0% 0.0% 0.0% 3.11sec 2471294 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars_sunfire 202497 2478018 8256 19.22 17855 37472 96.4 96.1 40.4% 0.0% 0.0% 0.0% 3.09sec 2478018 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 orbit_breaker 274283 1675361 5582 1.28 180910 380244 6.4 6.4 40.7% 0.0% 0.0% 0.0% 47.31sec 1675361 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 starfire 194153 1822770 6073 5.40 49338 98431 26.0 27.0 37.0% 0.0% 0.0% 0.0% 11.51sec 1822770 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 starsurge 78674 24148283 80451 23.31 146638 304041 116.9 116.6 38.4% 0.0% 0.0% 0.0% 2.56sec 24148283 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 goldrinns_fang 394047 8457097 28175 7.67 154272 317685 38.6 38.4 40.5% 0.0% 0.0% 0.0% 7.66sec 8457097 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 sunfire 93402 235300 784 3.48 9971 20218 17.4 17.4 34.6% 0.0% 0.0% 0.0% 18.05sec 4007690 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 sunfire ticks -93402 3772390 12575 62.96 8883 18019 17.4 314.8 33.9% 0.0% 0.0% 0.0% 18.05sec 4007690 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.30sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 denizen_of_the_flame 426486 650478 2167 1.73 60498 120881 8.7 8.7 24.0% 0.0% 0.0% 0.0% 31.30sec 650478 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 denizen_of_the_flame_secondary 426431 599075 1996 3.36 28772 57486 16.8 16.8 24.0% 0.0% 0.0% 0.0% 15.20sec 599075 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.14sec 0 300.16sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 wrath 190984 7159209 23851 23.50 41806 86352 118.0 117.5 42.9% 0.0% 0.0% 0.0% 2.49sec 7159209 300.16sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 astral_smolder ticks -394061 5404591 18015 23.77 45473 0 67.5 118.9 0.0% 0.0% 0.0% 0.0% 4.39sec 5404591 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.34sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 fey_missile 188046 2397222 7989 30.59 12159 24295 153.9 153.0 28.9% 0.0% 0.0% 0.0% 1.73sec 2397222 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 hungering_shadowflame 424324 1217651 4058 3.49 54064 108291 17.4 17.4 29.0% 0.0% 0.0% 0.0% 16.60sec 1217651 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 hungering_shadowflame_self 424324 698417 2327 3.49 31032 62044 17.4 17.4 29.0% 0.0% 0.0% 0.0% 16.60sec 793484 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 192.44sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 launched_thorns 379403 1117727 3725 6.90 25150 50260 34.6 34.5 28.9% 0.0% 0.0% 0.0% 8.56sec 1117727 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 71.81sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonfire 8921 190070 633 2.87 9602 19687 14.4 14.4 36.1% 0.0% 0.0% 0.0% 21.60sec 3997451 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonfire ticks -8921 3807381 12691 62.75 8678 18126 14.4 313.8 36.6% 0.0% 0.0% 0.0% 21.60sec 3997451 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 full_moon 274283 2607315 8689 1.06 338287 663731 5.3 5.3 47.7% 0.0% 0.0% 0.0% 62.48sec 2607315 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 new_moon 274281 1914349 6380 1.20 206835 432842 6.0 6.0 50.0% 0.0% 0.0% 0.0% 53.57sec 1914349 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 half_moon 274282 2564170 8545 1.13 292893 583237 5.7 5.7 55.1% 0.0% 0.0% 0.0% 57.78sec 2564170 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.34sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 overwhelming_rage ticks -374037 775505 2585 3.93 39465 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.73sec 880385 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.42sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars_moonfire 202497 2470627 8233 19.16 17205 36121 96.1 95.8 45.3% 0.0% 0.0% 0.0% 3.12sec 2470627 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars_sunfire 202497 2474184 8245 19.22 17185 36061 96.4 96.1 45.3% 0.0% 0.0% 0.0% 3.08sec 2474184 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 orbit_breaker 274283 1672316 5573 1.28 174058 365208 6.4 6.4 45.8% 0.0% 0.0% 0.0% 47.27sec 1672316 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 starfire 194153 1816816 6055 5.40 47488 94788 26.0 27.0 41.9% 0.0% 0.0% 0.0% 11.49sec 1816816 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 starsurge 78674 24128989 80411 23.31 141238 292887 116.8 116.6 43.3% 0.0% 0.0% 0.0% 2.55sec 24128989 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 goldrinns_fang 394047 8461150 28197 7.68 148626 306165 38.6 38.4 45.6% 0.0% 0.0% 0.0% 7.65sec 8461150 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 sunfire 93402 234746 782 3.48 9603 19425 17.4 17.4 39.6% 0.0% 0.0% 0.0% 18.05sec 4006934 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 sunfire ticks -93402 3772188 12574 62.94 8562 17366 17.4 314.7 38.9% 0.0% 0.0% 0.0% 18.05sec 4006934 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.84sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 denizen_of_the_flame 426486 673092 2243 1.73 60487 120897 8.6 8.6 28.9% 0.0% 0.0% 0.0% 31.84sec 673092 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 denizen_of_the_flame_secondary 426431 620522 2068 3.34 28767 57486 16.7 16.7 29.0% 0.0% 0.0% 0.0% 15.43sec 620522 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.20sec 0 300.07sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 wrath 190984 7134996 23778 23.50 40268 83043 118.0 117.5 47.8% 0.0% 0.0% 0.0% 2.49sec 7134996 300.07sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 astral_smolder ticks -394061 5067422 16891 22.94 44182 0 62.3 114.7 0.0% 0.0% 0.0% 0.0% 4.74sec 5067422 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.82sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 fey_missile 188046 2387392 7947 31.00 12329 24594 156.2 155.2 24.9% 0.0% 0.0% 0.0% 1.70sec 2387392 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 hungering_shadowflame 424324 1204349 4009 3.53 54591 109170 17.7 17.7 25.0% 0.0% 0.0% 0.0% 16.45sec 1204349 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 hungering_shadowflame_self 424324 678827 2260 3.53 30729 61804 17.7 17.7 24.9% 0.0% 0.0% 0.0% 16.45sec 784087 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.20sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 launched_thorns 379403 1120488 3730 7.07 25333 50875 35.5 35.4 24.8% 0.0% 0.0% 0.0% 8.29sec 1120488 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonfire 8921 188876 629 2.87 9756 20175 14.4 14.4 32.5% 0.0% 0.0% 0.0% 21.59sec 3968077 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonfire ticks -8921 3779200 12597 63.31 8784 18475 14.4 316.5 32.6% 0.0% 0.0% 0.0% 21.59sec 3968077 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moons_talent 274281 0 0 0.00 0 0 17.1 0.0 0.0% 0.0% 0.0% 0.0% 17.91sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 full_moon 274283 2590375 8623 1.06 344614 677438 5.3 5.3 43.5% 0.0% 0.0% 0.0% 62.26sec 2590375 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 new_moon 274281 1895363 6309 1.20 209887 441877 6.0 6.0 45.8% 0.0% 0.0% 0.0% 53.40sec 1895363 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 half_moon 274282 2556547 8510 1.13 298780 596737 5.7 5.7 51.0% 0.0% 0.0% 0.0% 57.61sec 2556547 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.31sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.57sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars_moonfire 202497 2474552 8237 19.31 17527 37044 97.0 96.7 41.3% 0.0% 0.0% 0.0% 3.09sec 2474552 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars_sunfire 202497 2482583 8264 19.40 17511 36981 97.4 97.1 41.3% 0.0% 0.0% 0.0% 3.07sec 2482583 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 orbit_breaker 274283 1680884 5595 1.29 177615 375531 6.5 6.5 41.9% 0.0% 0.0% 0.0% 46.85sec 1680884 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 starfire 194153 1775955 5912 5.37 47893 96018 25.9 26.9 37.8% 0.0% 0.0% 0.0% 11.56sec 1775955 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 starsurge 78674 24068589 80118 23.45 143646 299639 117.7 117.4 39.3% 0.0% 0.0% 0.0% 2.54sec 24068589 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 goldrinns_fang 394047 8435444 28079 7.72 151069 313066 38.8 38.6 41.5% 0.0% 0.0% 0.0% 7.69sec 8435444 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 sunfire 93402 231533 771 3.48 9721 19825 17.4 17.4 35.3% 0.0% 0.0% 0.0% 18.04sec 3976271 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 sunfire ticks -93402 3744739 12482 63.50 8660 17662 17.4 317.5 34.8% 0.0% 0.0% 0.0% 18.04sec 3976271 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.50sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 denizen_of_the_flame 426486 664647 2212 1.74 60927 122370 8.7 8.7 25.1% 0.0% 0.0% 0.0% 31.50sec 664647 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 denizen_of_the_flame_secondary 426431 610499 2032 3.37 28975 58196 16.9 16.9 24.8% 0.0% 0.0% 0.0% 15.30sec 610499 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.46sec 0 300.41sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 wrath 190984 7121712 23706 23.74 40702 84537 119.3 118.9 43.8% 0.0% 0.0% 0.0% 2.46sec 7121712 300.41sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 astral_smolder ticks -394061 5028727 16762 22.58 44537 0 60.3 112.9 0.0% 0.0% 0.0% 0.0% 4.89sec 5028727 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.58sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 fey_missile 188046 2410362 8035 30.76 12652 25263 154.7 153.8 24.0% 0.0% 0.0% 0.0% 1.69sec 2410362 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 hungering_shadowflame 424324 1170458 3902 3.50 54152 107461 17.5 17.5 24.0% 0.0% 0.0% 0.0% 16.44sec 1170458 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 hungering_shadowflame_self 424324 672857 2243 3.50 31033 62044 17.5 17.5 24.0% 0.0% 0.0% 0.0% 16.44sec 764521 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.51sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 launched_thorns 379403 1093497 3645 7.02 25153 50256 35.2 35.1 24.0% 0.0% 0.0% 0.0% 8.43sec 1093497 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonfire 8921 190037 633 2.87 9968 20488 14.3 14.3 31.2% 0.0% 0.0% 0.0% 21.60sec 3998131 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonfire ticks -8921 3808094 12694 62.73 9025 18877 14.3 313.7 31.6% 0.0% 0.0% 0.0% 21.60sec 3998131 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 full_moon 274283 2606357 8688 1.06 349610 685841 5.3 5.3 42.7% 0.0% 0.0% 0.0% 62.42sec 2606357 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 new_moon 274281 1907994 6360 1.20 214490 448499 6.0 6.0 44.7% 0.0% 0.0% 0.0% 53.54sec 1907994 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 half_moon 274282 2568466 8562 1.13 303015 602231 5.7 5.7 50.3% 0.0% 0.0% 0.0% 57.86sec 2568466 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.90sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars_moonfire 202497 2472545 8242 19.15 17899 37575 96.0 95.7 40.3% 0.0% 0.0% 0.0% 3.10sec 2472545 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars_sunfire 202497 2476654 8256 19.21 17875 37528 96.3 96.0 40.3% 0.0% 0.0% 0.0% 3.09sec 2476654 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 orbit_breaker 274283 1675248 5584 1.28 181293 380468 6.4 6.4 40.8% 0.0% 0.0% 0.0% 47.23sec 1675248 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 starfire 194153 1819207 6064 5.39 49372 98419 26.0 27.0 37.0% 0.0% 0.0% 0.0% 11.50sec 1819207 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 starsurge 78674 24163980 80550 23.31 146919 304298 116.8 116.5 38.4% 0.0% 0.0% 0.0% 2.55sec 24163980 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 goldrinns_fang 394047 8487024 28291 7.68 154412 318061 38.6 38.4 40.6% 0.0% 0.0% 0.0% 7.59sec 8487024 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 sunfire 93402 235388 785 3.48 9967 20258 17.4 17.4 34.6% 0.0% 0.0% 0.0% 18.04sec 4010891 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 sunfire ticks -93402 3775502 12585 62.92 8896 18045 17.4 314.6 33.9% 0.0% 0.0% 0.0% 18.04sec 4010891 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.02sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 denizen_of_the_flame 426486 648670 2162 1.73 60502 120891 8.7 8.7 23.9% 0.0% 0.0% 0.0% 31.02sec 648670 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 denizen_of_the_flame_secondary 426431 596819 1989 3.35 28774 57485 16.7 16.7 23.9% 0.0% 0.0% 0.0% 15.10sec 596819 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.24sec 0 299.99sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 wrath 190984 7165056 23884 23.50 41875 86411 118.0 117.5 42.9% 0.0% 0.0% 0.0% 2.49sec 7165056 299.99sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 astral_smolder ticks -394061 5002668 16676 22.62 44224 0 60.5 113.1 0.0% 0.0% 0.0% 0.0% 4.93sec 5002668 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.32sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 fey_missile 188046 2385653 7935 30.61 12554 25059 154.3 153.4 24.0% 0.0% 0.0% 0.0% 1.68sec 2385653 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 hungering_shadowflame 424324 1215058 4042 3.49 56016 111937 17.5 17.5 24.0% 0.0% 0.0% 0.0% 16.53sec 1215058 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 hungering_shadowflame_self 424324 681892 2268 3.49 31411 62806 17.5 17.5 24.1% 0.0% 0.0% 0.0% 16.53sec 790066 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 192.01sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 launched_thorns 379403 1131710 3764 7.02 25965 51877 35.3 35.2 24.0% 0.0% 0.0% 0.0% 8.47sec 1131710 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonfire 8921 189105 629 2.87 9901 20348 14.4 14.4 31.1% 0.0% 0.0% 0.0% 21.60sec 3976144 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonfire ticks -8921 3787039 12623 62.86 8952 18745 14.4 314.3 31.6% 0.0% 0.0% 0.0% 21.60sec 3976144 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 full_moon 274283 2599804 8648 1.06 348354 681225 5.3 5.3 43.0% 0.0% 0.0% 0.0% 62.55sec 2599804 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 new_moon 274281 1908959 6350 1.20 213425 447198 6.0 6.0 45.0% 0.0% 0.0% 0.0% 53.43sec 1908959 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 half_moon 274282 2557129 8506 1.13 301962 600445 5.7 5.7 49.9% 0.0% 0.0% 0.0% 57.82sec 2557129 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.31sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars_moonfire 202497 2461107 8186 19.14 17766 37311 96.2 95.9 40.4% 0.0% 0.0% 0.0% 3.11sec 2461107 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars_sunfire 202497 2464214 8197 19.21 17738 37262 96.5 96.3 40.3% 0.0% 0.0% 0.0% 3.09sec 2464214 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 orbit_breaker 274283 1668640 5550 1.28 179726 377776 6.4 6.4 40.8% 0.0% 0.0% 0.0% 47.28sec 1668640 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 starfire 194153 1811560 6026 5.40 48934 97754 26.1 27.1 36.9% 0.0% 0.0% 0.0% 11.51sec 1811560 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 starsurge 78674 24046078 79985 23.30 145749 302335 117.0 116.8 38.4% 0.0% 0.0% 0.0% 2.56sec 24046078 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 goldrinns_fang 394047 8437939 28067 7.68 153345 315655 38.7 38.5 40.6% 0.0% 0.0% 0.0% 7.67sec 8437939 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 sunfire 93402 233900 778 3.48 9901 20074 17.4 17.4 34.6% 0.0% 0.0% 0.0% 18.05sec 3987848 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 sunfire ticks -93402 3753948 12513 63.05 8827 17912 17.4 315.2 33.9% 0.0% 0.0% 0.0% 18.05sec 3987848 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.08sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 denizen_of_the_flame 426486 670819 2231 1.73 62447 124761 8.7 8.7 24.1% 0.0% 0.0% 0.0% 31.08sec 670819 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 denizen_of_the_flame_secondary 426431 616742 2051 3.34 29695 59342 16.8 16.8 24.0% 0.0% 0.0% 0.0% 15.20sec 616742 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.24sec 0 300.63sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 wrath 190984 7122867 23693 23.50 41530 85780 118.2 117.7 42.9% 0.0% 0.0% 0.0% 2.49sec 7122867 300.63sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
229389.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 5.9 0.0 50.8s 50.8s 46.3s 91.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 323.7s
  • trigger_min/max:6.0s / 323.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.7s
  • uptime_min/max:66.41% / 99.73%

Stack Uptimes

  • waning_twilight_1:91.09%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.9 0.0 50.9s 50.9s 46.5s 91.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 339.2s
  • trigger_min/max:6.0s / 339.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.0s
  • uptime_min/max:68.73% / 99.73%

Stack Uptimes

  • waning_twilight_1:91.11%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.9 0.0 50.9s 50.9s 46.5s 91.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 329.0s
  • trigger_min/max:6.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.2s
  • uptime_min/max:59.52% / 99.73%

Stack Uptimes

  • waning_twilight_1:91.12%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.2 0.0 57.7s 57.7s 54.2s 93.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 340.5s
  • trigger_min/max:6.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.9s
  • uptime_min/max:69.69% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.23%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 53.0s 53.1s 49.2s 91.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 339.3s
  • trigger_min/max:6.0s / 339.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.7s
  • uptime_min/max:71.73% / 99.73%

Stack Uptimes

  • waning_twilight_1:91.67%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.9 0.0 50.9s 50.9s 46.4s 91.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 344.0s
  • trigger_min/max:6.0s / 344.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.8s
  • uptime_min/max:68.70% / 99.71%

Stack Uptimes

  • waning_twilight_1:91.07%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 126310
Mean 300.15
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.7158
5th Percentile 246.05
95th Percentile 354.02
( 95th Percentile - 5th Percentile ) 107.97
Mean Distribution
Standard Deviation 0.0977
95.00% Confidence Interval ( 299.96 - 300.34 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 514
0.1% Error 51389
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1029
DPS
Fluffy_Pillow Damage Per Second
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 126310
Mean 246248.69
Minimum 205331.02
Maximum 293570.68
Spread ( max - min ) 88239.66
Range [ ( max - min ) / 2 * 100% ] 17.92%
Standard Deviation 9691.0110
5th Percentile 230710.42
95th Percentile 262535.40
( 95th Percentile - 5th Percentile ) 31824.99
Mean Distribution
Standard Deviation 27.2678
95.00% Confidence Interval ( 246195.25 - 246302.13 )
Normalized 95.00% Confidence Interval ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5950
0.1 Scale Factor Error with Delta=300 801719
0.05 Scale Factor Error with Delta=300 3206874
0.01 Scale Factor Error with Delta=300 80171839
HPS
Fluffy_Pillow Healing Per Second
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 126310
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 4803
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 80359153 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.